Update README.md
Browse files
README.md
CHANGED
@@ -39,9 +39,9 @@ from transformers import AutoModel, AutoTokenizer
|
|
39 |
tokenizer = AutoTokenizer.from_pretrained('qilowoq/AbLang_heavy')
|
40 |
model = AutoModel.from_pretrained('qilowoq/AbLang_heavy', trust_remote_code=True)
|
41 |
|
42 |
-
sequence_Example = ' '.join("
|
43 |
encoded_input = tokenizer(sequence_Example, return_tensors='pt')
|
44 |
-
model_output = model(encoded_input)
|
45 |
```
|
46 |
|
47 |
Sequence embeddings can be produced as follows:
|
|
|
39 |
tokenizer = AutoTokenizer.from_pretrained('qilowoq/AbLang_heavy')
|
40 |
model = AutoModel.from_pretrained('qilowoq/AbLang_heavy', trust_remote_code=True)
|
41 |
|
42 |
+
sequence_Example = ' '.join("EVQLQESGPGLVKPSETLSLTCTVSGGPINNAYWTWIRQPPGKGLEYLGYVYHTGVTNYNPSLKSRLTITIDTSRKQLSLSLKFVTAADSAVYYCAREWAEDGDFGNAFHVWGQGTMVAVSSASTKGPSVFPLAPSSKSTSGGTAALGCL")
|
43 |
encoded_input = tokenizer(sequence_Example, return_tensors='pt')
|
44 |
+
model_output = model(**encoded_input)
|
45 |
```
|
46 |
|
47 |
Sequence embeddings can be produced as follows:
|