Spaces:
Sleeping
Sleeping
File size: 6,023 Bytes
884b6ae 8165629 884b6ae 6e9c18e 884b6ae 8165629 884b6ae bbe157e 884b6ae 0cf7233 bbe157e 0cf7233 884b6ae 469bcfa bbe157e 884b6ae bbe157e 623a8df 0cf7233 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 |
from huggingface_hub import login
from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
import os
import gradio as gr
from gradio_molecule3d import Molecule3D
# This will prompt you to get an API key from huggingface hub, make one with
# "Read" or "Write" permission and copy it back here.
TOKEN = os.getenv("HF_TOKEN")
login(TOKEN)
# This will download the model weights and instantiate the model on your machine.
model: ESM3InferenceClient = ESM3.from_pretrained("esm3_sm_open_v1").to("cpu")
def read_mol(molpath):
with open(molpath, "r") as fp:
lines = fp.readlines()
mol = ""
for l in lines:
mol += l
return mol
def molecule(input_pdb):
mol = read_mol(input_pdb)
x = (
"""<!DOCTYPE html>
<html>
<head>
<meta http-equiv="content-type" content="text/html; charset=UTF-8" />
<style>
body{
font-family:sans-serif
}
.mol-container {
width: 100%;
height: 600px;
position: relative;
}
.mol-container select{
background-image:None;
}
</style>
<script src="https://cdnjs.cloudflare.com/ajax/libs/jquery/3.6.3/jquery.min.js" integrity="sha512-STof4xm1wgkfm7heWqFJVn58Hm3EtS31XFaagaa8VMReCXAkQnJZ+jEy8PCC/iT18dFy95WcExNHFTqLyp72eQ==" crossorigin="anonymous" referrerpolicy="no-referrer"></script>
<script src="https://3Dmol.csb.pitt.edu/build/3Dmol-min.js"></script>
</head>
<body>
<div id="container" class="mol-container"></div>
<script>
let pdb = `"""
+ mol
+ """`
$(document).ready(function () {
let element = $("#container");
let config = { backgroundColor: "white" };
let viewer = $3Dmol.createViewer(element, config);
viewer.addModel(pdb, "pdb");
viewer.getModel(0).setStyle({}, { cartoon: { colorscheme:"whiteCarbon" } });
viewer.zoomTo();
viewer.render();
viewer.zoom(0.8, 2000);
})
</script>
</body></html>"""
)
return f"""<iframe style="width: 100%; height: 600px" name="result" allow="midi; geolocation; microphone; camera;
display-capture; encrypted-media;" sandbox="allow-modals allow-forms
allow-scripts allow-same-origin allow-popups
allow-top-navigation-by-user-activation allow-downloads" allowfullscreen=""
allowpaymentrequest="" frameborder="0" srcdoc='{x}'></iframe>"""
def prediction(prompt, temperature, do_structure):
protein = ESMProtein(sequence=prompt)
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8, temperature=temperature))
if do_structure == "Yes":
protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8))
protein.to_pdb("./generation.pdb")
html = molecule("./generation.pdb")
seq = protein.sequence
protein.sequence = None
protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8))
protein.coordinates = None
protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8))
protein.to_pdb("./round_tripped.pdb")
html1 = molecule("./round_tripped.pdb")
return seq, protein.sequence, html, html1, "./round_tripped.pdb", "./generation.pdb",
else:
f = open("./empty.pdb", "w")
f.write("\n")
f.close()
return protein.sequence, "Inverse folding and re-generation not enabled", "<h3>Structure reconstruction not enabled</h3>", "<h3>Inverse folding and re-generation not enabled</h3>", "./empty.pdb", "./empty.pdb"
reps = [
{
"model": 0,
"chain": "",
"resname": "",
"style": "stick",
"color": "whiteCarbon",
"residue_range": "",
"around": 0,
"byres": False,
"visible": False
}
]
demo = gr.Interface(fn = prediction, inputs = [gr.Textbox(label="Masked protein sequence", info="Use '_' as masking character", value="___________________________________________________DQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPP___________________________________________________________"), gr.Slider(0,1,label="Temperature"), gr.Radio(["Yes", "No"], label="Reconstruct structure", info="Choose wheter to reconstruct structure or not, allowing also inverse folding-powered double check")], outputs = [gr.Textbox(label="Originally predicted sequence", show_copy_button=True),gr.Textbox(label="Inverse folding predicted sequence", show_copy_button=True),gr.HTML(label="Predicted 3D structure"),gr.HTML(label="Inverse-folding predicted 3D structure"), Molecule3D(label="Inverse-folding predicted molecular structure", reps=reps), Molecule3D(label="Predicted molecular structure", reps=reps)], title="""<h1 align='center'>Proteins with ESM</h1>
<h2 align='center'>Predict the whole sequence and 3D structure of masked protein sequences!</h2>
<h3 align='center'>Support this space with a ⭐ on <a href='https://github.com/AstraBert/proteins-w-esm'>GitHub</a></h3>
<h3 align='center'>Support Evolutionary Scale's ESM with a ⭐ on <a href='https://github.com/evolutionaryscale/esm'>GitHub</a></h3>""", examples = [["___________________________________________________DQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPP___________________________________________________________", 0.7, "No"], ["__________________________________________________________AGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE___________________________", 0.2, "Yes"], ["__________KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH________", 0.5, "Yes",]], cache_examples=False)
demo.launch() |