fixed bad sting in PPI demo, moved to IBM theme for the colors

app.py

@@ -58,24 +58,34 @@ def create_application():
                 *visibility,
             )
         else:
-            return (gr.skip, *visibility)
-        # return model_name_dropdown
+            return (gr.update(visible=False), *visibility)
+    
+    def model_change(value):
+        return gr.update(link=f"https://huggingface.co/{value}",visible=True)
 
-    with gr.Blocks() as application:
+    with gr.Blocks(theme="Zarkel/IBM_Carbon_Theme") as application:
         task_dropdown = gr.Dropdown(
             choices=["Select task"] + list(all_tasks.keys()), label="Mammal Task"
         )
         task_dropdown.interactive = True
-        model_name_dropdown = gr.Dropdown(
-            choices=[
-                model_name
-                for model_name, model in all_models.items()
-                if task_dropdown.value in model.tasks
-            ],
-            interactive=True,
-            label="Matching Mammal models",
-            visible=False,
-        )
+        with gr.Row() :
+            model_name_dropdown = gr.Dropdown(
+                choices=[
+                    model_name
+                    for model_name, model in all_models.items()
+                    if task_dropdown.value in model.tasks
+                ],
+                interactive=True,
+                label="Matching Mammal models",
+                visible=False,
+                scale=10,
+            )
+            goto_card_button = gr.Button("Link to model card",size='sm',scale=0,visible=False)
+            model_name_dropdown.change(
+                model_change,
+                inputs=[model_name_dropdown],
+                outputs=[goto_card_button]
+            )
 
         task_dropdown.change(
             task_change,
@@ -86,6 +96,7 @@ def create_application():
                 for task in all_tasks
             ],
         )
+            
 
         # def set_demo_vis(main_text):
         #     main_text=main_text

mammal_demo/ppi_task.py

@@ -19,7 +19,7 @@ class PpiTask(MammalTask):
             "protein_calmodulin": "MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISELDQDGFIDKEDLHDGDGKISFEEFLNLVNKEMTADVDGDGQVNYEEFVTMMTSK",
             "protein_calcineurin": "MSSKLLLAGLDIERVLAEKNFYKEWDTWIIEAMNVGDEEVDRIKEFKEDEIFEEAKTLGTAEMQEYKKQKLEEAIEGAFDIFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRQMWDQNGDWDRIKELKFGEIKKLSAKDTRGTIFIKVFENLGTGVDSEYEDVSKYMLKHQ",
         }
-        self.markup_text = """
+        self.markup_text = f"""
     # Mammal based {self.description} demonstration
 
     Given two protein sequences, estimate if the proteins interact or not."""