Spaces:
Running
Running
File size: 14,479 Bytes
56fa79a ffa70f2 56fa79a |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 |
<!DOCTYPE html>
<html>
<head>
<link rel="stylesheet" href="https://ebi.emblstatic.net/web_guidelines/EBI-Icon-fonts/v1.2/fonts.css" type="text/css" media="all"/>
<script src="https://d3js.org/d3.v4.min.js" charset="utf-8"></script>
<script type="text/javascript" src="https://www.ebi.ac.uk/pdbe/pdb-component-library/js/protvista-pdb-3.3.0.js"></script>
</head>
<body>
<h4>ProtVista PDB custom data demo</h4>
<div>
<protvista-pdb custom-data="true" id="pv1"></protvista-pdb>
</div>
<script>
document.addEventListener('DOMContentLoaded', () => {
//Get web-component element
const pvInstance = document.getElementById('pv1');
if(!pvInstance) return;
(async () => {
// PDBe sequence conservation api data
let scFetch = await fetch('https://www.ebi.ac.uk/pdbe/graph-api/uniprot/sequence_conservation/P29373');
let scResponseData = await scFetch.json();
const seqConservationData = scResponseData;
// seqConservationData is a json array with following fields. Please refer the fetch api url for the data struture
// [
// {
// "start": 1,
// "end": 1,
// "conservation_score": 1,
// "tooltipContent": "Conservation score: 1",
// "amino": [
// {
// "end": 1,
// "letter": "P",
// "proba": 0.428,
// "start": 1,
// "color": "#c0c000",
// "tooltipContent": "Amino acid: PRO<br/>Probability: 42.80%"
// },...
// ]
// }...
// ]
// PDBe variation api data
let vrFetch = await fetch('https://www.ebi.ac.uk/pdbe/graph-api/uniprot/protvista/variation/P29373');
let vrResponseData = await vrFetch.json();
const variationData = vrResponseData;
// variationData is a json with following fields. Please refer the fetch api url for the data struture
// {
// "sequence": "PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE",
// "variants": [
// {
// "accession": "NC_000001.11:g.156705439T>C",
// "association": [],
// "clinicalSignificances": null,
// "color": "#002594",
// "end": "2",
// "polyphenScore": 0.003,
// "siftScore": 0.055,
// "sourceType": "large_scale_study",
// "start": "2",
// "tooltipContent": "XYZ Variant",
// "variant": "S",
// "xrefNames": [
// "gnomAD"
// ],
// "keywords": [ // Keywords are used to filter the variats
// "predicted",
// "large_scale_studies"
// ]
// },...
// ]
// }
//Custom data model
const customData = {
displayNavigation: true, // Set to false to hide navigation scale
displaySequence: true, // Set to false to hide sequence track
sequence: 'MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE', //Protein sequence
length: 138, // Length of the sequence
offset: 1, // Offset navigation scale start. Example offset:10 will display the navigation start from 10 instead of default 1.
tracks: [ // Array of track objects (PDBe implementation extends core ProtVista track component. Refer - https://github.com/ebi-webcomponents/nightingale/tree/master/packages/protvista-track#data-array for all the supported track properties )
{
label: "Domains", // Track label
labelType: "text", // Supported values 'text' and 'html'
data: [
{
accession: "d1", // Some unique id
type: "UniProt range", // Displayed in tooltip title
label: "Domain 1", // Expected values 'text' and 'html'
labelTooltip: "Residues mapped to domain 1", // Label tooltip content. Support text and HTML mark-up
locations: [ // Array of sub-tracks
{
fragments : [ // Array of sub-track fragments
{
start: 1, // Track start value
end: 56, // Track end value
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56", // track tooltip content. Support text and HTML mark-up
color: "rgb(135,158,247)" // track (fragment) colour, supported rgb and hex code value
},
{
start: 70,
end: 130,
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130",
color: "rgb(160,174,232)"
}
]
}
]
},
{
accession: "d2",
type: "UniProt range",
label: "<div><i class='icon icon-generic' data-icon=';' style='color: #000;'></i> <a href='resource.xyz'>Domain 2</a></div>", //HTML strcutured label with font-icons. You can add any HTML markup.
labelTooltip: "<strong>Domain Compound</strong><br><img src='https://www.ebi.ac.uk/pdbe/static/files/pdbechem_v2/REA_200.svg'>", // labelTooltip HTML mark-up example displaying compound image in the tooltip.
locations: [
{
fragments : [
{
start: 1,
end: 20,
tooltipContent: "<strong>Type: domain 2</strong><br>Range: XY1 - XYZ20<br><a href='resource.xyz' style='color:blue'>view details</a>", // tooltipContent HTML mark-up example
color: "rgb(107,119,39)"
},
{
start: 22,
end: 137,
tooltipContent: "Type: domain 2<br>Range: XYZ22 - XYZ137",
color: "rgb(90,102,23)"
}
]
}
]
}
]
},
{
label: "Annotations",
labelType: "text",
labelColor: "rgb(128,128,128)", // Set labelColor to change label background colour
data: [
{
accession: "a1",
type: "UniProt range",
label: "Annotations 1",
labelType: "text",
labelTooltip: "Residues mapped to annotations 1",
labelColor: "rgb(211,211,211)",
color: "rgb(255,99,163)",
locations: [
{
fragments : [
{
start: 1,
end: 56,
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56"
},
{
start: 70,
end: 130,
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
}
]
}
]
}
]
},
{
label: "Annotation shapes",
data: [
{
accession: "s1",
type: "UniProt range",
label: "Circle",
color: "rgb(249,166,2)",
shape: 'circle', // supported shapes rectangle|bridge|diamond|chevron|catFace|triangle|wave|hexagon|pentagon|circle|arrow|doubleBar,
locations: [
{
fragments : [
{
start: 5,
end: 5,
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56",
},
{
start: 9,
end: 9,
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
}
]
}
]
},
{
accession: "s2",
type: "UniProt range",
label: "Diamond",
shape: 'diamond',
color: "rgb(255,99,163)", // Default colour value for all fragments in this track
locations: [
{
fragments : [
{
start: 5,
end: 5,
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56"
},
{
start: 9,
end: 9,
color: "rgb(0,128,129)", // Set colour here for individual shape fragment. This will override the track default colour.
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
},
{
start: 20,
end: 20,
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
},
{
start: 22,
end: 22,
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
}
]
}
]
}
]
}
],
sequenceConservation: seqConservationData, // Set this property to display your own sequence conservation data. Refer comments at the top for data structure.
variants: variationData, // Set this property to display your own variation data. Refer comments at the top for data structure.
legends: {
alignment: 'right', // expected values 'left', 'right' or 'center'
data: { // Legend Row, key is used as the row label
"Domains": [ // legends for Domains row
{
color: ["rgb(135,158,247)", "rgb(160,174,232)"], // legend color, supported rgb and hex code value
text: "Domains 1" // legend text
},
{
color: ["rgb(107,119,39)", "rgb(90,102,23)"],
text: "Domains 2"
}
],
"Annotations": [ // legends for Annotation row row
{
color: ["rgb(255,99,163)"],
text: "Custom Annotations"
}
]
}
}
};
// Assign custom data object to instance viewerdata property
pvInstance.viewerdata = customData;
})();
});
</script>
</body>
</html>
|