Spaces:
Runtime error
Runtime error
import gradio as gr | |
from ps4_eval.eval import sample_new_sequence | |
from ps4_data.get_embeddings import generate_embedings | |
def pred(residue_seq): | |
embs = generate_embedings(residue_seq)["residue_embs"]["0"] | |
preds = sample_new_sequence(embs, "ps4_models/Mega/PS4-Mega_loss-0.633_acc-78.176.pt") | |
return preds | |
iface = gr.Interface( | |
fn=pred, | |
title="Protein Secondary Structure Prediction with PS4-Mega", | |
description="🧬 Predict protein secondary structure from single sequence input using PS4-Mega and ProtT5-XL-UniRef50 (Elnaggar et al., 2020).\n💻 Official github repo: https://github.com/omarperacha/ps4-dataset\n📝 Offical paper: https://www.biorxiv.org/content/10.1101/2023.02.28.530456", | |
inputs=[gr.Textbox(label="Residue Sequence", value="")], | |
outputs=[gr.Textbox(label="Secondary Structure", value="")], | |
examples=[ | |
["HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA"], | |
["AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA"] | |
] | |
) | |
iface.queue().launch(debug=True) | |