Update app.py

app.py

@@ -148,16 +148,53 @@ description = """Quick demonstration of the FAPM model for protein function pred
 
 The model used in this app is available at [Hugging Face Model Hub](https://huggingface.co/wenkai/FAPM) and the source code can be found on [GitHub](https://github.com/xiangwenkai/FAPM/tree/main)."""
 
-iface = gr.Interface(
-    fn=generate_caption,
-    inputs=[gr.Textbox(type="text", label="Upload sequence"), gr.Textbox(type="text", label="Prompt")],
-    outputs=gr.Textbox(label="Generated description"),
-    description=description
-)
-
-# Launch the interface
-iface.launch()
-
-
 
+# iface = gr.Interface(
+#     fn=generate_caption,
+#     inputs=[gr.Textbox(type="text", label="Upload sequence"), gr.Textbox(type="text", label="Prompt")],
+#     outputs=gr.Textbox(label="Generated description"),
+#     description=description
+# )
+# # Launch the interface
+# iface.launch()
+
+
+css = """
+  #output {
+    height: 500px; 
+    overflow: auto; 
+    border: 1px solid #ccc; 
+  }
+"""
+
+with gr.Blocks(css=css) as demo:
+    gr.Markdown(description)
+    with gr.Tab(label="Protein caption"):
+        with gr.Row():
+            with gr.Column():
+                input_protein = gr.Textbox(type="text", label="Upload sequence")
+                # model_selector = gr.Dropdown(choices=list(models.keys()), label="Model", value='microsoft/Florence-2-large')
+                prompt = gr.Textbox(type="text", label="Prompt")
+                submit_btn = gr.Button(value="Submit")
+            with gr.Column():
+                output_text = gr.Textbox(label="Output Text")
+        # index 99, 127, 266, 738, 1060
+        gr.Examples(
+            examples=[
+                ["MKTLLLTLVVVTIVCLDLGNSLKCYVSREGKTQTCPEGEKLCEKYAVSYFHDGRWRYRYECTSACHRGPYNVCCSTDLCNK", 'Micrurus'],
+                ["MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI", 'Homo'],
+                ["MKTLALFLVLVCVLGLVQSWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC", 'Sophophora'],
+                ["MAARGAMLRYLRVNVNPTIQNPRECVLPFSILLRRFSEEVRGSFLDKSEVTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKIQSIDLAVDFIASHPQAK", 'Arabidopsis'],
+                ["MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS", 'Homo']
+            ],
+            inputs=[input_protein, prompt],
+            outputs=[output_text],
+            fn=generate_caption,
+            cache_examples=True,
+            label='Try examples'
+        )
+
+        submit_btn.click(generate_caption, [input_protein, prompt], [output_text])
+
+demo.launch(debug=True)