|
--- |
|
tags: |
|
- proteins |
|
- Biology |
|
- classifier |
|
--- |
|
## Model info |
|
|
|
A finetuned Bert-Base-Uncased model for a multilabel classificaton task involving predicting |
|
protein functions based on their amino acid sequences. |
|
The model takes sequence data and protein class name as input and |
|
outputs probability scores. (How likely is it that this sequence belongs to this group) |
|
|
|
|
|
|
|
|
|
## Model Usage |
|
|
|
|
|
The way you use this model for a demo is, you paste a protein sequence |
|
into the inference box and it outputs the relevant probabilities that certain GO terms are |
|
associated with that sequence. |
|
For example MMSTTHLLVFLLGVVTLTTPTFGTYESPNYGKPPTPVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYPGHPPLGKPQ |
|
|
|
|
|
outputs the following score |
|
``` |
|
[ |
|
[ |
|
{ |
|
"label": "GO:0000122", |
|
"score": 0.29775485396385193 |
|
}, |
|
{ |
|
"label": "GO:0000070", |
|
"score": 0.10477513074874878 |
|
}, |
|
{ |
|
"label": "GO:0000075", |
|
"score": 0.08593793958425522 |
|
}, |
|
{ |
|
"label": "GO:0000118", |
|
"score": 0.05860009789466858 |
|
}, |
|
{ |
|
"label": "GO:0000082", |
|
"score": 0.05373986065387726 |
|
}, |
|
{ |
|
"label": "GO:0000077", |
|
"score": 0.03928716108202934 |
|
}, |
|
{ |
|
"label": "GO:0000096", |
|
"score": 0.03705739229917526 |
|
}, |
|
{ |
|
"label": "GO:0000079", |
|
"score": 0.02797592058777809 |
|
}, |
|
{ |
|
"label": "GO:0000045", |
|
"score": 0.026528609916567802 |
|
}, |
|
{ |
|
"label": "GO:0000097", |
|
"score": 0.026119187474250793 |
|
}, |
|
{ |
|
"label": "GO:0000086", |
|
"score": 0.019697198644280434 |
|
}, |
|
{ |
|
"label": "GO:0000049", |
|
"score": 0.018551582470536232 |
|
}, |
|
{ |
|
"label": "GO:0000041", |
|
"score": 0.016929756850004196 |
|
}, |
|
{ |
|
"label": "GO:0000054", |
|
"score": 0.015105823054909706 |
|
}, |
|
{ |
|
"label": "GO:0000083", |
|
"score": 0.01434631273150444 |
|
}, |
|
{ |
|
"label": "GO:0000105", |
|
"score": 0.013960960321128368 |
|
}, |
|
{ |
|
"label": "GO:0000076", |
|
"score": 0.013064960949122906 |
|
}, |
|
{ |
|
"label": "GO:0000109", |
|
"score": 0.012523632496595383 |
|
}, |
|
{ |
|
"label": "GO:0000113", |
|
"score": 0.012152223847806454 |
|
}, |
|
{ |
|
"label": "GO:0000062", |
|
"score": 0.01127714291214943 |
|
}, |
|
{ |
|
"label": "GO:0000101", |
|
"score": 0.011041304096579552 |
|
}, |
|
``` |
