Datasets:

caldervf

/

cicero_clean_dataset

like 0

63337ba81f476ee1f0530a0a

D.C.'s Preschool Teacher Education Requirement Won't Help Working Families

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dreamstime_xxl_599258202400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dreamstime_xxl_599258201200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dreamstime_xxl_59925820600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dreamstime_xxl_59925820331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dreamstime_xxl_599258202400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dreamstime_xxl_599258201200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dreamstime_xxl_59925820600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dreamstime_xxl_59925820331x186jpg 331w img width1200 altkids in preschool srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpg height675 picture div pspanafter a nearly sixyear legal battle the deadlines for compliance with washington dcs controversial licensing regulations for preschool teachers are nearingspanp pspanby this december all early childhood education center directors a hrefhttpsossedcgoveceresourcestextassociate20degree20aa20in20earlycredit20hours20in20early20childhoodmusta spanspanhave a bachelors degree with at least 15 credits of early childhood education classes by december 2023 all preschool teachers and many athome day care providers must havespan a hrefhttpsossedcgoveceresourcestextassociate20degree20aa20in20earlycredit20hours20in20early20childhoodspanobtainedspanaspan at least an associate degree with a minimum of 24 credits of early childhood education classes even assistant teachers must obtain a child development associate credential or an associate degree in any field by december 2023spanp pa hrefhttpsreasoncom20220815federalappealscourtupholdscollegedegreerequirementforchildcarestaffspancriticsspana of the requirement a hrefhttpsreasoncom20170331dcimplementsoppressivelicensingrequispannotespanaspan that the new rules will likelyspan a hrefhttpsreasoncom20180105everyonehatesdcsdaycaremandatespanincreasespanaspan dc day care tuitionalready thespan a hrefhttpswwwaxioscomlocalwashingtondc20220708dcexpensivechildcarespanhighestspanaspan in the usand put many qualified and experienced teachers out of a job spanp pspana a hrefhttpswwwoecdorgcompetitionreformwelfareeffectofoccuplicensing_morriskleinerpdf2019 studya published by the federal reserve bank of minneapolis found that quotthe welfare costs of licensingquotthe premium received by workers who meet licensing criteriaquotappear to exceed the benefitsquot study authors morris m kleiner of the university of minnesota and evan j soltas of mit found that quotshifting an occupation in a state from entirely unlicensed to entirely licensed increases state average wages in the licensed occupation by 15 percent increases hours per worker by 3 percent and reduces employment by 29 percentquot spanp pimposing occupational licensing on a field that previously did not require it pushes some people up the income ladder while pushing others out of the industry altogether workers who already meet licensing criteria when the rules go into effect seem to make more money as do workers who can quickly satisfy the criteria workers who cannot afford the new educational requirementsfor lack of time money or englishlanguage proficiencymust find other work this reduces the number of day care workers the number of children who need care meanwhile will not ebb simply because there are fewer teachers and a hrefhttpsossedcgovsitesdefaultfilesdcsitesossepublicationattachmentsproviding20child20care20faqs2071811apdfgovernmentmandated teachertochilda ratios prevent fewer day care workers from taking care of the same number of childrenp pin essence unless every current provider can comply with the new licensing requirements or be quickly replaced by credentialed workers the same number of children competing for fewer spots will drive up costs to families who need carep pquotdcs college requirement for day care staff is not just bad policy it is also unconstitutional the college requirement violates daycare providers right to earn a living without unreasonable government interferencequot wrote the a hrefhttpsijorgcasewashingtondcdaycareeducationinstitute for justicea a libertarian public interest law firm about its lawsuit challenging the regulations quotdc is imposing real burdens on day care staff and parentsquotp pa hrefhttpswwwwashingtonpostcomopinions20220909dcschildcareregulationswillimproveoutcomeschildrenspansupportersspanaspan of the regulations have chosen to focus on the purported benefits of highlycredentialed preschool teachers seemingly dismissing concerns over costsboth to parents and to current teachers who dont meet the requirementsspanp pspankathy hollowellmakle executive director of the district of columbia association for the education of young childrenspan spandcaeycspanspan a hrefhttpswwwwashingtonpostcomopinions20220923earlychildhoodeducationpayequitywrotea recently for emthe washington postem that quotstudies consistently show that young children receiving highquality early education develop expansive vocabulary possess stronger language skills and score better in math and science schoolreadiness assessmentsquotspanp pspanquotthis science is why every childnot only those whose parents can afford itshould have equitable access to a knowledgeable competent nurturing fairly compensated early educatorquot she arguedspanp pspanbut even if hollowellmakle is correct that bettercredentialed preschool teachers lead to higher educational attainment for toddlers and young children she barely acknowledges the tradeoffs spanquotdelivering on quality has costsbut the benefits are public and the investments must be tooquot she writesp pquotday care providers like ilumi worry about the time and money needed to obtain a college education while working full timequot wrote the a hrefhttpsijorgcasewashingtondcdaycareeducationinstitute for justicea profiling one such worker who will be hurt by the new credentialing requirements quotmany are older women who have years of experience caring for children but no experience writing a term paper on imoby dicki younger people may have their own families to take care ofquotp pspanas these new regulations go into effect experienced and skilled day care workersespecially those who need to work to livewill be forced out of the market and away from the families who rely on them for child care and parents will pay more for fewer options spanp pthe post a relnofollow hrefhttpsreasoncom20220927dcspreschoolteachereducationrequirementwonthelpworkingfamiliesdcs preschool teacher education requirement wont help working familiesa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dreamstime_xxl_599258202400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dreamstime_xxl_599258201200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dreamstime_xxl_59925820600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dreamstime_xxl_59925820331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dreamstime_xxl_599258202400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dreamstime_xxl_599258201200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dreamstime_xxl_59925820600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dreamstime_xxl_59925820331x186jpg 331w img width1200 altkids preschool srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dreamstime_xxl_59925820800x450jpg height675 picture div pspanafter nearly sixyear legal battle deadlines compliance washington dcs controversial licensing regulations preschool teachers nearingspanp pspanby december early childhood education center directors hrefhttpsossedcgoveceresourcestextassociate20degree20aa20in20earlycredit20hours20in20early20childhoodmusta spanspanhave bachelors degree 15 credits early childhood education classes december 2023 preschool teachers athome day care providers havespan hrefhttpsossedcgoveceresourcestextassociate20degree20aa20in20earlycredit20hours20in20early20childhoodspanobtainedspanaspan associate degree minimum 24 credits early childhood education classes assistant teachers obtain child development associate credential associate degree field december 2023spanp pa hrefhttpsreasoncom20220815federalappealscourtupholdscollegedegreerequirementforchildcarestaffspancriticsspana requirement hrefhttpsreasoncom20170331dcimplementsoppressivelicensingrequispannotespanaspan new rules likelyspana hrefhttpsreasoncom20180105everyonehatesdcsdaycaremandatespanincreasespanaspan dc day care tuitionalready thespan hrefhttpswwwaxioscomlocalwashingtondc20220708dcexpensivechildcarespanhighestspanaspan usand qualified experienced teachers job spanp pspana hrefhttpswwwoecdorgcompetitionreformwelfareeffectofoccuplicensing_morriskleinerpdf2019 studya published federal reserve bank minneapolis found quotthe welfare costs licensingquotthe premium received workers meet licensing criteriaquotappear exceed benefitsquot study authors morris m kleiner university minnesota evan j soltas mit found quotshifting occupation state entirely unlicensed entirely licensed increases state average wages licensed occupation 15 percent increases hours worker 3 percent reduces employment 29 percentquotspanp pimposing occupational licensing field previously require pushes people income ladder pushing industry altogether workers meet licensing criteria rules effect money workers quickly satisfy criteria workers afford new educational requirementsfor lack time money englishlanguage proficiencymust find work reduces number day care workers number children need care ebb simply fewer teachers hrefhttpsossedcgovsitesdefaultfilesdcsitesossepublicationattachmentsproviding20child20care20faqs2071811apdfgovernmentmandated teachertochilda ratios prevent fewer day care workers taking care number childrenp pin essence current provider comply new licensing requirements quickly replaced credentialed workers number children competing fewer spots drive costs families need carep pquotdcs college requirement day care staff bad policy unconstitutional college requirement violates daycare providers right earn living unreasonable government interferencequot wrote hrefhttpsijorgcasewashingtondcdaycareeducationinstitute justicea libertarian public interest law firm lawsuit challenging regulations quotdc imposing real burdens day care staff parentsquotp pa hrefhttpswwwwashingtonpostcomopinions20220909dcschildcareregulationswillimproveoutcomeschildrenspansupportersspanaspan regulations chosen focus purported benefits highlycredentialed preschool teachers seemingly dismissing concerns costsboth parents current teachers dont meet requirementsspanp pspankathy hollowellmakle executive director district columbia association education young childrenspan spandcaeycspanspan hrefhttpswwwwashingtonpostcomopinions20220923earlychildhoodeducationpayequitywrotea recently emthe washington postem quotstudies consistently young children receiving highquality early education develop expansive vocabulary possess stronger language skills score better math science schoolreadiness assessmentsquotspanp pspanquotthis science childnot parents afford itshould equitable access knowledgeable competent nurturing fairly compensated early educatorquot arguedspanp pspanbut hollowellmakle correct bettercredentialed preschool teachers lead higher educational attainment toddlers young children barely acknowledges tradeoffs spanquotdelivering quality costsbut benefits public investments tooquot writesp pquotday care providers like ilumi worry time money needed obtain college education working timequot wrote hrefhttpsijorgcasewashingtondcdaycareeducationinstitute justicea profiling worker hurt new credentialing requirements quotmany older women years experience caring children experience writing term paper imoby dicki younger people families care ofquotp pspanas new regulations effect experienced skilled day care workersespecially need work livewill forced market away families rely child care parents pay fewer optionsspanp pthe post relnofollow hrefhttpsreasoncom20220927dcspreschoolteachereducationrequirementwonthelpworkingfamiliesdcs preschool teacher education requirement wont help working familiesa appeared relnofollow hrefhttpsreasoncomreasoncomap

63337bfb1f476ee1f0530a0d

'Flagrantly Illegal': Law Firm Files Lawsuit To Stop Biden's Student Loan Forgiveness

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dpaphotossix0341152400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dpaphotossix0341151200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dpaphotossix034115600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dpaphotossix034115331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dpaphotossix0341152400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dpaphotossix0341151200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dpaphotossix034115600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dpaphotossix034115331x186jpg 331w img width1200 altbiden attends a press conference srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpg height675 picture div ppresident joe bidens plan to forgive hundreds of billions of dollars in student loan debt violates both federal law and the constitution according to a hrefhttpsreasoncomwpcontentuploads202209embargoed11ameasternsep27202220220927garrisonvusdeptofeducationcomplaintpdfa justfiled lawsuita from the pacific legal foundation plf a libertarian law firmp pquotthis isnt how laws are supposed to be madequot caleb kruckenberg an attorney for plf tells emreasonem quotonly congress has the power to pass laws and spend money under the constitution the administrations actions here are flagrantly illegalquotp pthis is the first serious challenge to bidens student loan forgiveness plan which he announced last month the lawsuits plaintiff is frank garrison whos also an attorney at plf garrison borrowed federal student loans to pay for law school but according to him bidens debt forgiveness plan will actually subject him to a financial penalty in the form of a state tax this gives him standing to sue the us education department his lawsuit arguesp pquotdespite the staggering scope of this regulatory action it was taken with breathtaking informality and opacityquot the lawsuit claims quotin the rush the administration has created new problems for borrowers in at least six states that tax loan cancellation as incomequotp paccording to garrison he is already receiving debt relief under public service loan forgiveness pslf a federal program for borrowers who work in public service at nonprofit organizations qualifying borrowers who make a certain number of payments and meet maximum income requirements can have the rest of their debts forgiven by pslf garrison expects to qualify in about four yearsp pimportantly debt relief under pslf is not subject to state taxes bidens broad forgiveness plan however will be taxed as income in indianawhere garrison residesas well as wisconsin north carolina minnesota mississippi and arkansas garrison will be quotstuck with a tax bill that makes him financially worse off than continuing with his repayment program under pslfquot according to the lawsuit quothe did not ask for cancellation doesnt want it and has no way to opt out of itquotp pquotthe administrations slapdash lawmakingbypressrelease approach to student debt cancellation threatens to leave tens of thousands of borrowers stuck with a tax bill on money theyll never see in states like indiana where it will be taxed as incomequot says kruckenbergp pwhile the pacific legal foundations theory is that this gives garrison standing to sue the education department the lawsuits case against the biden forgiveness plan is more straightforward plf is arguing that biden has violated both the constitution and the administrative procedure act which give congress rather than the president the power to make new regulationsp pbidens new plan a hrefhttpsreasoncom20220824bidenstudentloandebtforgivenesscancelwill forgive up to 20000 worth of debta for many borrowers the plan could cost us taxpayers anywhere a hrefhttpsbudgetmodelwhartonupenneduissues2022823forgivingstudentloansbetween 300 billion and a trillion dollarsa a low estimate of the cost per individual taxpayer is a hrefhttpstwittercomandrew_lautzstatus15621592642605547532100ap pthe administration has claimed that it has the power to unilaterally forgive student loan debts without consulting congress a hrefhttpsreasoncom20220920ifthepandemicisoveranditisthenbidensemergencypowersshouldendtooas justificationa biden has cited 2003s higher education relief opportunities for students or heroes act this law gave the president some authority to cancel or delay student loan repayments during national emergencies with the clear intention of offering relief to borrowers who were serving in combat operations during the war on terror bidens view is that the covid19 pandemic counts as a national emergency even though he has now a hrefhttpstwittercom60minutesstatus1571652540592050176declareda it definitively quotoverquotp pplfs lawsuit takes issue with the pandemic justification for debt relief noting that the harms purportedly ameliorated with debt forgiveness are not a quotdirect resultquot of the quotnational emergencyquot as required by the heroes actp pquotto the extent the statute can arguably justify the cancellation the major questions doctrine requires a clear authorization by congress of such an economically and politically significant action which is lacking herequot the lawsuit arguesp ploan forgiveness is set to kick in sometime next monthp pthe post a relnofollow hrefhttpsreasoncom20220927bidenstudentloanforgivenesslawsuitpacificlegalfoundationflagrantly illegal law firm files lawsuit to stop bidens student loan forgivenessa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dpaphotossix0341152400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dpaphotossix0341151200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dpaphotossix034115600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dpaphotossix034115331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209dpaphotossix0341152400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209dpaphotossix0341151200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209dpaphotossix034115600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209dpaphotossix034115331x186jpg 331w img width1200 altbiden attends press conference srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209dpaphotossix034115800x450jpg height675 picture div ppresident joe bidens plan forgive hundreds billions dollars student loan debt violates federal law constitution according hrefhttpsreasoncomwpcontentuploads202209embargoed11ameasternsep27202220220927garrisonvusdeptofeducationcomplaintpdfa justfiled lawsuita pacific legal foundation plf libertarian law firmp pquotthis isnt laws supposed madequot caleb kruckenberg attorney plf tellsemreasonem quotonly congress power pass laws spend money constitution administrations actions flagrantly illegalquotp pthis challenge bidens student loan forgiveness plan announced month lawsuits plaintiff frank garrison whos attorney plf garrison borrowed federal student loans pay law school according bidens debt forgiveness plan actually subject financial penalty form state tax gives standing sue education department lawsuit arguesp pquotdespite staggering scope regulatory action taken breathtaking informality opacityquot lawsuit claims quotin rush administration created new problems borrowers states tax loan cancellation incomequotp paccording garrison receiving debt relief public service loan forgiveness pslf federal program borrowers work public service nonprofit organizations qualifying borrowers certain number payments meet maximum income requirements rest debts forgiven pslf garrison expects qualify yearsp pimportantly debt relief pslf subject state taxes bidens broad forgiveness plan taxed income indianawhere garrison residesas wisconsin north carolina minnesota mississippi arkansas garrison quotstuck tax bill makes financially worse continuing repayment program pslfquot according lawsuit quothe ask cancellation doesnt want way opt itquotp pquotthe administrations slapdash lawmakingbypressrelease approach student debt cancellation threatens leave tens thousands borrowers stuck tax bill money theyll states like indiana taxed incomequot says kruckenbergp pwhile pacific legal foundations theory gives garrison standing sue education department lawsuits case biden forgiveness plan straightforward plf arguing biden violated constitution administrative procedure act congress president power new regulationsp pbidens new plan hrefhttpsreasoncom20220824bidenstudentloandebtforgivenesscancelwill forgive 20000 worth debta borrowers plan cost taxpayers hrefhttpsbudgetmodelwhartonupenneduissues2022823forgivingstudentloansbetween 300 billion trillion dollarsa low estimate cost individual taxpayer hrefhttpstwittercomandrew_lautzstatus15621592642605547532100ap pthe administration claimed power unilaterally forgive student loan debts consulting congress hrefhttpsreasoncom20220920ifthepandemicisoveranditisthenbidensemergencypowersshouldendtooas justificationa biden cited 2003s higher education relief opportunities students heroes act law gave president authority cancel delay student loan repayments national emergencies clear intention offering relief borrowers serving combat operations war terror bidens view covid19 pandemic counts national emergency hrefhttpstwittercom60minutesstatus1571652540592050176declareda definitively quotoverquotp pplfs lawsuit takes issue pandemic justification debt relief noting harms purportedly ameliorated debt forgiveness quotdirect resultquot quotnational emergencyquot required heroes actp pquotto extent statute arguably justify cancellation major questions doctrine requires clear authorization congress economically politically significant action lacking herequot lawsuit arguesp ploan forgiveness set kick monthp pthe post relnofollow hrefhttpsreasoncom20220927bidenstudentloanforgivenesslawsuitpacificlegalfoundationflagrantly illegal law firm files lawsuit stop bidens student loan forgivenessa appeared relnofollow hrefhttpsreasoncomreasoncomap

63337d9b1f476ee1f0530a61

Where Does the Desire to Kill Come From?

img altwhere does the desire to kill come from srchttpswisdomofcrowdslivecontentimages202209201484fgsdl1jpgpthe crowd is flying solo duo again for this weeks episode focusing on recent developments in the war in ukraine iranian protests and europes undertheradar political upheavals the russian government recently declared a quotpartial mobilizationquot to aid in the war effort and vladimir putin threatened to defend russias gains with nuclear weapons how much affect will mobilization have on the course of the war what kind of precedent does it set to seize territory then defend those gains with nuclear threatsppthen we turned to the recent protests shaking iranand a larger discussion of how authoritarian regimes hold onto power have governments become better at crushing dissent in recent years and why do dictators seem to love running a dictatorshipan often unpleasant jobso muchpaudio controls source srchttpscvwsicloudcontentcombaubdywnderogrowejozmdnxow1jkaukb8giy0zegz0yffhjpnyarg8dwocauthoritariancoups_mainmixdownmp3oasr9l4cprj0v9rbcu725jxjma2d_a3pm8zwocj8pcgwv1x3acaogdkf8zpvxartiwpp0nrpkdduptju_bclbxfj0mpgk78gsard3ty_xtzay95lr2lcwigeaugrow1jkwgqarg8dairtmrswrvive9al1nqs0w17eh6chldng7oc7o4deo3eglxi9llyje4jwwpylp4gxdavnfs96no1iw8lmgpqna3vcz2bzp7abz_gwqe1664217696flr85e7c1108d154dba80fb7b051732ab211ktx4j6hclwplfgv8lplswygckccomappleclouddocsckzcomappleclouddocsp24s037cvqd8unu8zorr211oct9xi6gcdi pyour browser doesnt support html audio a hrefhttpswocpremiums3amazonawscomwocsdbonusfinal_mixdownmp3herea is a link to the filep audiopin strongpart 2 strongstronga hrefhttpswisdomofcrowdslivetheriseandfalloftheswedishmodelavailable herea strongfor subscribers we talked about the recent success of far right parties in europe the sweden democrats a party with roots in neofascism have become the second biggest political party in swedens parliament if sweden is as tolerant as many americans would like it to be what explains their rise the countrys recent rise in muslim immigration as well as crime might point to an answer although we disagree on the quotsolutionsquot can a crackdown on crime forestall a farright backlash is muslim integration helped or harmed by such methods and why do hobbits come into itppemrequired readingempullinothing has really changed in moscow the fighting is worlds away by valerie hopkins a hrefhttpswwwnytimescomlive20220907worldukrainerussiawarinmoscowthefightingisaworldawaysmidurlshareemthe new york timesemalilihobbits and the hard right how fantasy inspires italys potential new leader by jason horowitz a hrefhttpswwwnytimescom20220921worldeuropegiorgiamelonilordoftheringshtmlemthe new york timesemalilihow italy is facing a crucial election gideon rachmans interview with nathalie tocci a hrefhttpswwwftcomcontent30c87d16e14443c693d23ba43a55aa46emthe financial timesemaliliwill jean monnets vision for europe win out damirs a hrefhttpswwwatlanticcouncilorgcontentseriesatlanticdebriefatlanticdebriefwilljeanmonnetsvisionforeuropewinoutadebrieffromnathalietocciinterviewa with nathalie tocci for the atlantic councilliliemememthe happiness labems a hrefhttpspodcastsapplecomdkpodcastmovetoyourhappyplaceid1474245040i1000577695635episodea on denmarkememlilieuropes growing muslim population a report from the a hrefhttpswwwpewresearchorgreligion20171129europesgrowingmuslimpopulationpew research centeralililead americas real criminal element kevin drum a hrefhttpswwwmotherjonescomenvironment201602leadexposuregasolinecrimeincreasechildrenhealthemmother jonesemaliul

img altwhere desire kill come srchttpswisdomofcrowdslivecontentimages202209201484fgsdl1jpgpthe crowd flying solo duo weeks episode focusing recent developments war ukraine iranian protests europes undertheradar political upheavals russian government recently declared quotpartial mobilizationquot aid war effort vladimir putin threatened defend russias gains nuclear weapons affect mobilization course war kind precedent set seize territory defend gains nuclear threatsppthen turned recent protests shaking iranand larger discussion authoritarian regimes hold power governments better crushing dissent recent years dictators love running dictatorshipan unpleasant jobso muchpaudio controls source srchttpscvwsicloudcontentcombaubdywnderogrowejozmdnxow1jkaukb8giy0zegz0yffhjpnyarg8dwocauthoritariancoups_mainmixdownmp3oasr9l4cprj0v9rbcu725jxjma2d_a3pm8zwocj8pcgwv1x3acaogdkf8zpvxartiwpp0nrpkdduptju_bclbxfj0mpgk78gsard3ty_xtzay95lr2lcwigeaugrow1jkwgqarg8dairtmrswrvive9al1nqs0w17eh6chldng7oc7o4deo3eglxi9llyje4jwwpylp4gxdavnfs96no1iw8lmgpqna3vcz2bzp7abz_gwqe1664217696flr85e7c1108d154dba80fb7b051732ab211ktx4j6hclwplfgv8lplswygckccomappleclouddocsckzcomappleclouddocsp24s037cvqd8unu8zorr211oct9xi6gcdi pyour browser doesnt support html audio hrefhttpswocpremiums3amazonawscomwocsdbonusfinal_mixdownmp3herea link filep audiopin strongpart 2 strongstronga hrefhttpswisdomofcrowdslivetheriseandfalloftheswedishmodelavailable herea strongfor subscribers talked recent success far right parties europe sweden democrats party roots neofascism second biggest political party swedens parliament sweden tolerant americans like explains rise countrys recent rise muslim immigration crime point answer disagree quotsolutionsquot crackdown crime forestall farright backlash muslim integration helped harmed methods hobbits come itppemrequired readingempullinothing changed moscow fighting worlds away valerie hopkins hrefhttpswwwnytimescomlive20220907worldukrainerussiawarinmoscowthefightingisaworldawaysmidurlshareemthe new york timesemalilihobbits hard right fantasy inspires italys potential new leader jason horowitz hrefhttpswwwnytimescom20220921worldeuropegiorgiamelonilordoftheringshtmlemthe new york timesemalilihow italy facing crucial election gideon rachmans interview nathalie tocci hrefhttpswwwftcomcontent30c87d16e14443c693d23ba43a55aa46emthe financial timesemaliliwill jean monnets vision europe win damirs hrefhttpswwwatlanticcouncilorgcontentseriesatlanticdebriefatlanticdebriefwilljeanmonnetsvisionforeuropewinoutadebrieffromnathalietocciinterviewa nathalie tocci atlantic councilliliemememthe happiness labems hrefhttpspodcastsapplecomdkpodcastmovetoyourhappyplaceid1474245040i1000577695635episodea denmarkememlilieuropes growing muslim population report hrefhttpswwwpewresearchorgreligion20171129europesgrowingmuslimpopulationpew research centeralililead americas real criminal element kevin drum hrefhttpswwwmotherjonescomenvironment201602leadexposuregasolinecrimeincreasechildrenhealthemmother jonesemaliul

63337d9d1f476ee1f0530a63

The Rise and Fall of the Swedish Model

img altthe rise and fall of the swedish model srchttpswisdomofcrowdslivecontentimages20220914249posdl11jpgpin strongpart 2 strongstrongavailable here strongfor subscribers we talked about the recent success of far right parties in europe the sweden democrats a party with roots in neofascism have become the second biggest political party in swedens parliament if sweden is as tolerant as many americans would like it to be what explains their rise the countrys recent rise in muslim immigration as well as crime might point to an answer although we disagree on the quotsolutionsquot if there are any can a crackdown on crime forestall a farright backlash is muslim integration helped or harmed by such methods and why do hobbits come into itppif you missed strongpart 1strong its available a hrefhttpswisdomofcrowdslivetheriseandfalloftheswedishmodelatasteofauthoritarianism2hereap

img altthe rise fall swedish model srchttpswisdomofcrowdslivecontentimages20220914249posdl11jpgpin strongpart 2 strongstrongavailable strongfor subscribers talked recent success far right parties europe sweden democrats party roots neofascism second biggest political party swedens parliament sweden tolerant americans like explains rise countrys recent rise muslim immigration crime point answer disagree quotsolutionsquot crackdown crime forestall farright backlash muslim integration helped harmed methods hobbits come itppif missed strongpart 1strong available hrefhttpswisdomofcrowdslivetheriseandfalloftheswedishmodelatasteofauthoritarianism2hereap

63337e5f1f476ee1f0530a88

Valuing the Deep State Part III: A State of Courts and Parties

img altvaluing the deep state part iii a state of courts and parties srchttpswwwamericanpurposecomcontentimages202209screenshot20220926at124211pmpngpemthird article in a series on bureaucratic autonomy the first installment can be found a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea and the second a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiihereaemppwe now come to the american state having spent a lot of time thinking about public sector reform in developing countries it seemed to me important to look at the dysfunctions of the american public sector as wellppin the course of my career i have had the enormous fortune to study under several great academic mentors alan bloom and harvey mansfield who taught me political theory samuel huntington who exposed me to the idea of political development and seymour martin lipset who helped me secure my first academic position and was a colleague at george mason universityppive often said that everything i know about american politics came from marty lipset i had never taken a political science course on american politics either as an undergraduate or in graduate school and so was selftaught in this area when i first started at george mason marty had just published his bookem a hrefhttpswwwamazoncomamericanexceptionalismseymourmartinlipsetdp0393316149refsr_1_4crid3sjydwvppjb8kkeywordsseymourlipsetqid1662762230sbookssprefixseymourlipset2cstripbooks2c115sr14american exceptionalism a doubleedged swordaem where he talked about the unique features of american political culture he and i taught a graduate seminar together built around this book a course that i went on to teach myself at johns hopkins school of advanced international studies and at stanford___steady_paywall___ppmarty argued that hostility to the state was one of the most enduring features of american political culture this proclivity arose out of the american revolution and the colonists struggle against british monarchical authority distrust of state authority existed both on the right and left while the left tended to want more government programs it often had an equally cynical view of government being controlled by malign elitesppaccording to lipset american antistatism was manifest across the board in american political development the american state was less extensive and slower to develop than its counterparts in europe while germany began a social security program in the 1880s america did not follow suit until the 1930s while virtually every other developed democracy created a governmentmandated system of universal health insurance early in the 20supthsup century america succeeded in getting this in place in 2010 with obamas affordable care act which the republicans denounced as socialism and spent the better part of the next decade trying to repealppthe american state nonetheless grew enormously during the 20supthsup century first during the progressive era then under the new deal and finally during the 1970s with the addition of a host of new federal agencies dealing with issues from occupational safety and health to environmental protection most observers of comparative statebuilding would argue however that the american state while extensive tends to be of lower quality than its rich country counterparts state modernization came later than in europes most advanced democracies and has regressed over timeppin the second volume of my empolitical orderem series i looked at state modernization efforts across a variety of countries the creation of theem grands coles emand emconseil dtatem in france the steinhardenberg reforms in prussia and the northcotetrevelyan reforms in britain i was strongly influenced by martin shefters theory that such modernizations had occurred under authoritarian regimes facing national security threats in prussiagermany france britain and other countries their autonomous bureaucracies then survived into a democratic era by contrast countries such as italy and greece opened up the democratic franchise before such state modernization had occurred allowing democraticallyelected politicians to use the state for patronage purposes this led to widespread clientelism and corruption which was subsequently hard to reverseppthe united states was a country that both demonstrated the shefter thesis but also contravened it it began to open up the franchise to all white men beginning in the 1820s and politicians seeking votes found that the easiest way to mobilize support was to bribe voters with a christmas turkey or bottle of bourbon or else to give them a job in the post office this widened franchise brought to power our first populist president andrew jackson who on being elected in 1828 declared first that he won the election and therefore could decide who would serve in government and second that any ordinary american could fill a government position thus began the socalled patronage or spoils system in which virtually every us official from cabinet secretaries to fourthclass postmasters got their jobs as a reward for supporting a politician the patronage system defined american bureaucracy for much of the next century the us government was in political scientist stephen skowroneks words a state of courts and parties lacking a modern europeanstyle bureaucracyppstate modernization in the united states began in earnest in 1883 with passage of the pendleton act the driver here was not military competition but the recognition by both the business community and a nascent civil society that the spoils system was not delivering the kind of quality government required by a rapidly industrializing society the pendleton act created a us civil service commission and established meritbased criteria for hiring and promotion into the federal service  pfigureimg sizesminwidth 720px 720px srchttpswwwamericanpurposecomcontentimages202209pendleton2jpg altvaluing the deep state part iii a state of courts and parties width1139 srcsethttpswwwamericanpurposecomcontentimagessizew600202209pendleton2jpg 600w httpswwwamericanpurposecomcontentimagessizew1000202209pendleton2jpg 1000w httpswwwamericanpurposecomcontentimages202209pendleton2jpg 1139w height1600figcaptiongeorge pendletonfigcaptionfigurepexisting patronage politicians fiercely resisted the act because it took away the currency they used to get elected and would not have passed but for the assassination of newly elected president james a garfield by a disappointed officeseeker expansion of the classified service continued over the next decades at a slow pace and it was not until the time of the first world war that the majority of federal bureaucrats had been hired under it by contrast chinese bureaucrats were being selected for office through competitive examinations already at the time of the qin unification in 221 bc local party machines like tammany hall in new york or the daley machine in chicago didnt get cleaned up until nearly the middle of the 20supthsup centuryppin line with marty lipsets general observations about american exceptionalism the us bureaucracy still remains less professional than its european or asian counterparts in most other democracies a change in administration after an election leads to the turnover of the cabinet and perhaps a handful of each ministrys senior staff in the united states by contrast each election leads to the appointment of 40005000 schedule c political appointees a thousand of whom need senate confirmation the partnership for public service the countrys premiere organization concerned with reform issues recommends sharply reducing this number given the slowness of the appointment process and the poor quality of many of the appointeesppthe us federal bureaucracy has been in desperate need of reform for several decades but the kinds of reform now put on the table by republican opponents of the deep state would actually seek to dismantle the entire meritbased bureaucracy in favor of atwill employment that would in effect return the us government back to the situation that existed prior to the pendleton act the grounds for this reform will be the topic of the following postsppppemimage a caricature of andrew jackson as quotking andrew the firstquot likely published in the fall of 1833 a hrefhttpswwwlocgovpicturesitem2008661753library of congressaemp

img altvaluing deep state iii state courts parties srchttpswwwamericanpurposecomcontentimages202209screenshot20220926at124211pmpngpemthird article series bureaucratic autonomy installment found hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea second hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiihereaemppwe come american state having spent lot time thinking public sector reform developing countries important look dysfunctions american public sector wellppin course career enormous fortune study great academic mentors alan bloom harvey mansfield taught political theory samuel huntington exposed idea political development seymour martin lipset helped secure academic position colleague george mason universityppive said know american politics came marty lipset taken political science course american politics undergraduate graduate school selftaught area started george mason marty published bookem hrefhttpswwwamazoncomamericanexceptionalismseymourmartinlipsetdp0393316149refsr_1_4crid3sjydwvppjb8kkeywordsseymourlipsetqid1662762230sbookssprefixseymourlipset2cstripbooks2c115sr14american exceptionalism doubleedged swordaem talked unique features american political culture taught graduate seminar built book course went teach johns hopkins school advanced international studies stanford___steady_paywall___ppmarty argued hostility state enduring features american political culture proclivity arose american revolution colonists struggle british monarchical authority distrust state authority existed right left left tended want government programs equally cynical view government controlled malign elitesppaccording lipset american antistatism manifest board american political development american state extensive slower develop counterparts europe germany began social security program 1880s america follow suit 1930s virtually developed democracy created governmentmandated system universal health insurance early 20supthsup century america succeeded getting place 2010 obamas affordable care act republicans denounced socialism spent better decade trying repealppthe american state nonetheless grew enormously 20supthsup century progressive era new deal finally 1970s addition host new federal agencies dealing issues occupational safety health environmental protection observers comparative statebuilding argue american state extensive tends lower quality rich country counterparts state modernization came later europes advanced democracies regressed timeppin second volume empolitical orderem series looked state modernization efforts variety countries creation theem grands coles emand emconseil dtatem france steinhardenberg reforms prussia northcotetrevelyan reforms britain strongly influenced martin shefters theory modernizations occurred authoritarian regimes facing national security threats prussiagermany france britain countries autonomous bureaucracies survived democratic era contrast countries italy greece opened democratic franchise state modernization occurred allowing democraticallyelected politicians use state patronage purposes led widespread clientelism corruption subsequently hard reverseppthe united states country demonstrated shefter thesis contravened began open franchise white men beginning 1820s politicians seeking votes found easiest way mobilize support bribe voters christmas turkey bottle bourbon job post office widened franchise brought power populist president andrew jackson elected 1828 declared won election decide serve government second ordinary american fill government position began socalled patronage spoils system virtually official cabinet secretaries fourthclass postmasters got jobs reward supporting politician patronage system defined american bureaucracy century government political scientist stephen skowroneks words state courts parties lacking modern europeanstyle bureaucracyppstate modernization united states began earnest 1883 passage pendleton act driver military competition recognition business community nascent civil society spoils system delivering kind quality government required rapidly industrializing society pendleton act created civil service commission established meritbased criteria hiring promotion federal service pfigureimg sizesminwidth 720px 720px srchttpswwwamericanpurposecomcontentimages202209pendleton2jpg altvaluing deep state iii state courts parties width1139 srcsethttpswwwamericanpurposecomcontentimagessizew600202209pendleton2jpg 600w httpswwwamericanpurposecomcontentimagessizew1000202209pendleton2jpg 1000w httpswwwamericanpurposecomcontentimages202209pendleton2jpg 1139w height1600figcaptiongeorge pendletonfigcaptionfigurepexisting patronage politicians fiercely resisted act took away currency elected passed assassination newly elected president james garfield disappointed officeseeker expansion classified service continued decades slow pace time world war majority federal bureaucrats hired contrast chinese bureaucrats selected office competitive examinations time qin unification 221 bc local party machines like tammany hall new york daley machine chicago didnt cleaned nearly middle 20supthsup centuryppin line marty lipsets general observations american exceptionalism bureaucracy remains professional european asian counterparts democracies change administration election leads turnover cabinet handful ministrys senior staff united states contrast election leads appointment 40005000 schedule c political appointees thousand need senate confirmation partnership public service countrys premiere organization concerned reform issues recommends sharply reducing number given slowness appointment process poor quality appointeesppthe federal bureaucracy desperate need reform decades kinds reform table republican opponents deep state actually seek dismantle entire meritbased bureaucracy favor atwill employment effect return government situation existed prior pendleton act grounds reform topic following postsppppemimage caricature andrew jackson quotking andrew firstquot likely published fall 1833 hrefhttpswwwlocgovpicturesitem2008661753library congressaemp

6334cbdadfd197b0ed5b42d4

Healthcare Triage Podcast: Science Communication Matters

pin this episode dr krista hoffmannlongtin and dr tiffany doherty talk with dr aaron carroll about the importance of science communication they discuss some major challenges to effective communication as well as ways to try to bridge the communication gap and promote better understanding between scientists and the publicp p p piframe allowfullscreenallowfullscreen srchttpshtml5playerlibsyncomembedepisodeid24446187height90themecustomthumbnailyesdirectionforwardrenderplaylistnocustomcolor000000 width100 height90iframep p p pthis healthcare triage podcast episode is cosponsored by indiana university school of medicine whose mission is to advance health in the state of indiana and beyond by promoting innovation and excellence in education research and patient care and the indiana clinical and translational sciences institute a three way partnership among indiana university purdue university and the university of notre dame striving to make indiana a healthier state by empowering research through pilot funding research education and training more information on the indiana ctsi can be found by visiting indianactsiorgpthe post a hrefhttpstheincidentaleconomistcomwordpresshealthcaretriagepodcastsciencecommunicationmattershealthcare triage podcast science communication mattersa first appeared on a hrefhttpstheincidentaleconomistcomwordpressthe incidental economista

pin episode dr krista hoffmannlongtin dr tiffany doherty talk dr aaron carroll importance science communication discuss major challenges effective communication ways try bridge communication gap promote better understanding scientists publicp pp piframe allowfullscreenallowfullscreen srchttpshtml5playerlibsyncomembedepisodeid24446187height90themecustomthumbnailyesdirectionforwardrenderplaylistnocustomcolor000000 width100 height90iframep pp pthis healthcare triage podcast episode cosponsored indiana university school medicine mission advance health state indiana promoting innovation excellence education research patient care indiana clinical translational sciences institute way partnership indiana university purdue university university notre dame striving indiana healthier state empowering research pilot funding research education training information indiana ctsi found visiting indianactsiorgpthe post hrefhttpstheincidentaleconomistcomwordpresshealthcaretriagepodcastsciencecommunicationmattershealthcare triage podcast science communication mattersa appeared hrefhttpstheincidentaleconomistcomwordpressthe incidental economista

6334cc08dfd197b0ed5b42d9

Russ Roberts: Why Economists Suck at Explaining Life

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomics1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics1331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomics1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics1331x186jpg 331w img width1200 altrussrobertseconomics srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpg height675 picture div pspaneconomist a hrefhttpsrussrobertsinforuss robertsa is known for his extraordinary gift at finding creative ways of communicating the power of free market capitalism to the general public spanp pspanhes the host of the wildly successful podcastspanispan a hrefhttpswwwecontalkorgemecontalkemaspanispan which has been running weekly episodes since 2006 spanspanhes the author of three novels aspanspannd along with filmmaker john papola he created the blockbuster a hrefhttpswwwyoutubecomwatchvd0nertfoskkeynes vs hayek rap videosa  spanp pspanmore recently his interest has turned to the fundamental inadequacy of his chosen discipline to comprehend what matters most to peoplespanspan quoti came to realize that economiststend to focus on things that can be measuredquot he tells emreasonem quotdignity is hard to measure a sense of self is hard to measure belonging is hard to measure a feeling of transcendence is hard to measure matteringthat you are important that people look to you [these sorts of things are] about the life welllived and theyre not about getting the most out of your money theyre not about what the interest rates are next week and economists truthfully have virtually nothing to say about these thingsquotspanp pspanroberts new book is called spana hrefhttpswwwamazoncomexecobidosasin0593418255reasonmagazinea20ispanwild problemsspaniaspan and it deals with the decisions that define us whether to marry whether to have kids what kind of work to pursue he says these are the sorts of questions that cant be figured out with economic modeling and costbenefit analysesspanp pispanreasonspanispan talked with roberts about how he makes sense of a world that is richer than ever in material resources and yet suffers increasing numbers of quotdeaths of despairquot spanspanwe discuss spana hrefhttpsrussrobertsinfoaboutspanhis own lifespanaspan from earning a phd in economics at the university of chicago in the 1970sspanspan to becoming president of a hrefhttpsshalemacilenshalem collegea in israel to the central role that religion plays in his lifespanp pemphoto credits russell roberts cc bysa 40 via wikimedia commonsemp pemmusic credits quotlittle eyesinstrumental versionquot by yehezkel raz via artlistemp peminterview by nick gillespie edited by regan taylor and adam czarneckiemp pthe post a relnofollow hrefhttpsreasoncomvideo20220928russrobertswhyeconomistssuckatexplainingliferuss roberts why economists suck at explaining lifea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomics1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics1331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomics1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics1331x186jpg 331w img width1200 altrussrobertseconomics srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics1800x450jpg height675 picture div pspaneconomist hrefhttpsrussrobertsinforuss robertsa known extraordinary gift finding creative ways communicating power free market capitalism general publicspanp pspanhes host wildly successful podcastspanispan hrefhttpswwwecontalkorgemecontalkemaspanispan running weekly episodes 2006 spanspanhes author novels aspanspannd filmmaker john papola created blockbuster hrefhttpswwwyoutubecomwatchvd0nertfoskkeynes vs hayek rap videosaspanp pspanmore recently interest turned fundamental inadequacy chosen discipline comprehend matters peoplespanspan quoti came realize economiststend focus things measuredquot tells emreasonem quotdignity hard measure sense self hard measure belonging hard measure feeling transcendence hard measure matteringthat important people look [these sorts things are]about life welllived theyre getting money theyre interest rates week economists truthfully virtually thingsquotspanp pspanroberts new book called spana hrefhttpswwwamazoncomexecobidosasin0593418255reasonmagazinea20ispanwild problemsspaniaspan deals decisions define marry kids kind work pursue says sorts questions cant figured economic modeling costbenefit analysesspanp pispanreasonspanispan talked roberts makes sense world richer material resources suffers increasing numbers quotdeaths despairquot spanspanwe discuss spana hrefhttpsrussrobertsinfoaboutspanhis lifespanaspan earning phd economics university chicago 1970sspanspan president hrefhttpsshalemacilenshalem collegea israel central role religion plays lifespanp pemphoto credits russell roberts cc bysa 40 wikimedia commonsemp pemmusic credits quotlittle eyesinstrumental versionquot yehezkel raz artlistemp peminterview nick gillespie edited regan taylor adam czarneckiemp pthe post relnofollow hrefhttpsreasoncomvideo20220928russrobertswhyeconomistssuckatexplainingliferuss roberts economists suck explaining lifea appeared relnofollow hrefhttpsreasoncomreasoncomap

6334cc34dfd197b0ed5b42df

Biden, DeSantis put politics aside with Hurricane Ian bearing down

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden and gov ron desantis r put politics aside tuesday night and spoke about hurricane ian hitting florida a shift after biden hadnt spoken directly with his potential 2024 political rival in the leadup to the storm p pbefore the call the white house had been pressed on why biden hadnt called desantis a political foe who has leaned into culture wars and challenged the administration over the influx of migrants at the borderp pnews of the discussion silenced any criticism that politics might interfere with the governments response to the category 4 storm at least for the time beingp pvoters expect politicians of all stripes to put down their swords when a disaster strikes and its always advantageous to be able to cite one highprofile bipartisan action when challenged about your bipartisan bona fides said stewart verdery a former assistant secretary at the department of homeland security under former president george w bushp pformer rep chris carney dpa a biden ally said it benefits biden and desantis to be in discussionsp pi think its kind of unsurprising that there would be the washington game of speculation will they wont they carney said but i think ultimately when it comes to something as potentially catastrophic and devastating as a hurricane as strong as ian in this case the best politics is no politicsp pthe white house on wednesday when asked about the call stressed that there should be no politics involved in the response to hurricane ian which could bring more than 10 feet of lifethreatening storm surge to floridas west coast and has maximum sustained winds of more than 150 miles per hourp pthis is about the people of florida press secretary karine jeanpierre told reporters this is about two people who wanted to have a conversation on how we can be partners to the governor and his constituents and make sure that we are delivering for the people of floridap pflorida is a swing state in presidential contests and will help decide the senate majority this fall desantis is also up for reelectionp ponce youve won the election youre the governor or youre the president for all people said gop strategist doug heye thats certainly what biden won on whoever would breach that would look bad particularly to florida voters and floridas an important statep pcarney now a senior policy adviser at nossaman llp added that democrats understand that this is a life threatening catastrophic event and you kind of check your politics at the door in such a casep pbiden will be briefed at femas headquarters on thursday on the federal response to the hurricane and continue to receive regular briefings the white house has not yet said if biden will visit florida after ian passesp pthe storm is a key test for both menp ppresidents are always judged on their ability to handle natural disasters while desantis must manage a crisis in his home state as speculation swirls over if he will mount a white house bidp pafter talking to biden the governor went on air with fox newss sean hannity and lauded the administrations response to the hurricane so farp pwhen peoples lives and their property are at risk like this we all need to work together regardless of party lines desantis said its my sense that the administration wants to helpquot p pthis isnt the first disaster the sunshine state has faced that has brought biden and desantis togetherp pthe two appeared together in person last year as they toured damage and spoke about the response to the collapse of a condominium building in surfside fla that killed nearly 100 people p pbut the relationship has been tense more recently administration officials have condemned the governors support of the socalled dont say gay law that restricts discussion of sexual orientation in the classroom and more recently have called out desantis for flying migrants to marthas vineyard mass accusing him of using human beings as political propsp pthe bidendesantis call was only focused on the hurricane response and no other topic jeanpierre said wednesday when asked if the marthas vineyard controversy came upp pthe white house and federal emergency management agency administrator deanne criswell dodged questions on tuesday over why the president has not called desantis directly criswell said the lack of a call at the time had not impeded planning for the storm and that biden had personally talked to the mayors of tampa st petersburg and clearwaterp pone floridabased gop operative argued there is nothing to be gained politically for either desantis or biden by giving the other the cold shoulder or appearing to take politics into account with a major storm bearing down on the statep pthe operative noted that for desantis being able to work with the federal government to show he is handling the storm well is important to his reelection prospects and beyondp pbiden has been selective in his direct conversations with governors recentlyp phe did not directly contact mississippi gov tate reeves r about the water crisis in jackson but when hurricane fiona hit puerto rico biden immediately contacted the territorys democratic governor pedro pierluisip pthe political situation brought on by the hurricane this week is reminiscent to hurricane sandy which hit new jersey in 2012 p pformer new jersey gov chris christie r felt the ire of republicans after photographers captured pictures of him shaking hands with thenpresident obama who put his hand on the governors shoulder p pchristie was repeatedly put on the defensive during the 2016 gop presidential primary for embracing obamap pdemocratic strategists say bidens interaction with desantis though wont be a bad narrative for the florida governor p pand the call underscores bidens preferred brandp pone thing we know for sure is that president bidens brand is to rise above politics and hes got the pelts on the wall to prove it said democratic strategist joel paynep ppayne agreed that coming together at this time should be the priorityp pim not in the business of advising ron desantis but i think it would behoove any elected official to prioritize the best interests and wellbeing of their constituents over politics especially when lives are literally on the line he saidp pemamie parnes contributed to this reportemp

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden gov ron desantis r politics aside tuesday night spoke hurricane ian hitting florida shift biden hadnt spoken directly potential 2024 political rival leadup stormp pbefore white house pressed biden hadnt called desantis political foe leaned culture wars challenged administration influx migrants borderp pnews discussion silenced criticism politics interfere governments response category 4 storm time beingp pvoters expect politicians stripes swords disaster strikes advantageous able cite highprofile bipartisan action challenged bipartisan bona fides said stewart verdery assistant secretary department homeland security president george w bushp pformer rep chris carney dpa biden ally said benefits biden desantis discussionsp pi think kind unsurprising washington game speculation wont carney said think ultimately comes potentially catastrophic devastating hurricane strong ian case best politics politicsp pthe white house wednesday asked stressed politics involved response hurricane ian bring 10 feet lifethreatening storm surge floridas west coast maximum sustained winds 150 miles hourp pthis people florida press secretary karine jeanpierre told reporters people wanted conversation partners governor constituents sure delivering people floridap pflorida swing state presidential contests help decide senate majority fall desantis reelectionp ponce youve won election youre governor youre president people said gop strategist doug heye thats certainly biden won breach look bad particularly florida voters floridas important statep pcarney senior policy adviser nossaman llp added democrats understand life threatening catastrophic event kind check politics door casep pbiden briefed femas headquarters thursday federal response hurricane continue receive regular briefings white house said biden visit florida ian passesp pthe storm key test menp ppresidents judged ability handle natural disasters desantis manage crisis home state speculation swirls mount white house bidp pafter talking biden governor went air fox newss sean hannity lauded administrations response hurricane farp pwhen peoples lives property risk like need work regardless party lines desantis said sense administration wants helpquotp pthis isnt disaster sunshine state faced brought biden desantis togetherp pthe appeared person year toured damage spoke response collapse condominium building surfside fla killed nearly 100 peoplep pbut relationship tense recently administration officials condemned governors support socalled dont gay law restricts discussion sexual orientation classroom recently called desantis flying migrants marthas vineyard mass accusing human beings political propsp pthe bidendesantis focused hurricane response topic jeanpierre said wednesday asked marthas vineyard controversy came upp pthe white house federal emergency management agency administrator deanne criswell dodged questions tuesday president called desantis directly criswell said lack time impeded planning storm biden personally talked mayors tampa st petersburg clearwaterp pone floridabased gop operative argued gained politically desantis biden giving cold shoulder appearing politics account major storm bearing statep pthe operative noted desantis able work federal government handling storm important reelection prospects beyondp pbiden selective direct conversations governors recentlyp phe directly contact mississippi gov tate reeves r water crisis jackson hurricane fiona hit puerto rico biden immediately contacted territorys democratic governor pedro pierluisip pthe political situation brought hurricane week reminiscent hurricane sandy hit new jersey 2012p pformer new jersey gov chris christie r felt ire republicans photographers captured pictures shaking hands thenpresident obama hand governors shoulderp pchristie repeatedly defensive 2016 gop presidential primary embracing obamap pdemocratic strategists bidens interaction desantis wont bad narrative florida governorp pand underscores bidens preferred brandp pone thing know sure president bidens brand rise politics hes got pelts wall prove said democratic strategist joel paynep ppayne agreed coming time priorityp pim business advising ron desantis think behoove elected official prioritize best interests wellbeing constituents politics especially lives literally line saidp pemamie parnes contributed reportemp

6334cc36dfd197b0ed5b42e1

On The Lawn: Biden, DeSantis set differences aside and respond to Hurricane Ian

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure phurricane ian made landfall on floridas gulf coast wednesday p pthe category 4 storm could potentially bring more than 10 ft of lifethreatening storm surgep pahead of the storm president biden put politics aside and called florida gov ron desantis r tuesday evening the two spoke about the steps the federal government is taking to help florida prepare for hurricane ian and they committed to continued close coordinationp pthe white house previously stressed that the political differences between biden and desantis would not affect the administrations response to the hurricane desantis himself has indicated that he has a good relationship with the federal emergency management agency fema which has sent personnel to florida to assist in the states responsep pwatch the video above for more p

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure phurricane ian landfall floridas gulf coast wednesday p pthe category 4 storm potentially bring 10 ft lifethreatening storm surgep pahead storm president biden politics aside called florida gov ron desantis r tuesday evening spoke steps federal government taking help florida prepare hurricane ian committed continued close coordinationp pthe white house previously stressed political differences biden desantis affect administrations response hurricane desantis indicated good relationship federal emergency management agency fema sent personnel florida assist states responsep pwatch video morep

6334cc4adfd197b0ed5b42e5

IRS Sent $1.1 Billion in Child Welfare Payments to the Wrong People

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209childtaxcreditjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209childtaxcredit1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209childtaxcredit600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209childtaxcredit331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209childtaxcreditjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209childtaxcredit1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209childtaxcredit600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209childtaxcredit331x186jpg 331w img width1200 altchild welfare subsidy internal revenue service irs treasury pandemic covid19 child tax credit american rescue plan srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpg height675 picture div pin the first five months of sending expanded child welfare payments to american families the irs wasted emonly emabout 11 billionp pin other words this might be the federal governments most efficient pandemic spending effortdespite the huge amount of money sent to an estimated 15 million taxpayers who did not qualify for the paymentsp pan inspector general a hrefhttpswwwtreasurygovtigtaauditreports2022reports202247070frpdfreporta for the treasury department released tuesday details what the irs got right 98 percent of payments were distributed correctly and what it got wrong during the first five months of the expanded child welfare payments authorized by the american rescue plan which cleared congress in march 2021 the law increased the annual child tax credit paid to parents from 2000 to 3000 per child and 3600 for children under age 6 and made the tax credit fully refundablemeaning that parents could receive the benefits even if they paid no federal income taxes taxpayers with more than 75000 in annual income or couples that earned more than 150000 received smaller payments that phased out as income levels rosep peffectively it turned the child tax credit into a hrefhttpsreasoncom20210527expandingchildtaxcreditwillnotfightpovertya subsidy paid out by the irsa to parents in monthly installments the boosted payments applied only during 2021 but the structural changes to how the child tax credit operates are permanentp pfrom july when the law took effect through november of last year the irs distributed more than 76 billion in child welfare payments of that total about 11 billion was distributed to people who did not qualify for the payments while another 37 billion should have been paid to about 4 million taxpayers who qualified according to the reportp pthat means the irs made about 200 million in fraudulent or wrong payments each month which is simultaneously a staggering total and also a remarkably efficient result for a government spending programp pcompare that to other pandemicera efforts that have been a hrefhttpsreasoncom20210628governmentpandemicloansplaguedbypotential260billioninfraudplagued by frauda earlier this month federal prosecutors a hrefhttpswwwwashingtonpostcombusiness20220920pandemicfraudfoodchildrendojchargeda 47 people connected to a minnesota nonprofit with allegedly stealing 250 million from a pandemicera federal food program thats the largest scheme uncovered to date but its only one data point in a constellation of wasteful and fraudulent pandemicera spendingp pan estimated 10 percent of the paycheck protection programs a hrefhttpswwwcovidmoneytrackerorg820 billiona was a hrefhttpswwwnbcnewscompoliticsjusticedepartmentbiggestfraudgenerationlootingcovidreliefprogramknownpppn1279664stolen by fraudstersa and taxpayers ended up paying a hrefhttpswwwstlouisfedorgpublicationsregionaleconomist2022julwaspaycheckprotectionprogrameffectiveroughly 4 for every 1 of wages and benefitsa to workers meanwhile the federally boosted unemployment benefits were an even more costly mess with as much as a hrefhttpsreasoncom20220608watchdogreportatleast20percentoffederalpandemicunemploymentdollarswasted20 percent being wasteda according to a government accountability office gao report maybe the most wasteful effort of all was the federal aid to state and local governments with a hrefhttpsreasoncom20220621federalcovidaidtostatesandlocalitiescost855000perjobsavedtaxpayers dropping about 800000 per job saveda according to a national bureau of economic research working paperp pthe child welfare payments likely benefited from some structural arrangements that made the program less pervious to fraud for one the irs already has piles of data about taxpayers and their dependents from years of filed tax returns and rather than creating a new stimulus or welfare system out of whole cloth the boosted child subsidies were merely piling more money and a different distribution system onto an existing tax credit eligibility for the boosted child subsidies was based on taxpayers 2019 and 2020 tax returns which were already filed before the program was announcedp pin short if your goal is to defraud the federal government its easier to do that with a fake company or a fake unemployment claim than with a fake childp pstill the fact that this program resulted in more than 1 billion in wrongful payments in just five months despite all the structural advantages that it had over programs like the ppp says something too even when the federal government has all the tools it needs to effectively and correctly redistribute wealth a large pile of money is going to be wasted in the effortp pby any reasonable standard 1 billion in waste over just five months would be a failure grading on the government curve however makes this look almost like a successp pthe post a relnofollow hrefhttpsreasoncom20220928irssent11billioninchildwelfarepaymentstothewrongpeopleirs sent 11 billion in child welfare payments to the wrong peoplea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209childtaxcreditjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209childtaxcredit1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209childtaxcredit600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209childtaxcredit331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209childtaxcreditjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209childtaxcredit1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209childtaxcredit600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209childtaxcredit331x186jpg 331w img width1200 altchild welfare subsidy internal revenue service irs treasury pandemic covid19 child tax credit american rescue plan srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209childtaxcredit800x450jpg height675 picture div pin months sending expanded child welfare payments american families irs wasted emonly emabout 11 billionp pin words federal governments efficient pandemic spending effortdespite huge money sent estimated 15 million taxpayers qualify paymentsp pan inspector general hrefhttpswwwtreasurygovtigtaauditreports2022reports202247070frpdfreporta treasury department released tuesday details irs got right 98 percent payments distributed correctly got wrong months expanded child welfare payments authorized american rescue plan cleared congress march 2021 law increased annual child tax credit paid parents 2000 3000 child 3600 children age 6 tax credit fully refundablemeaning parents receive benefits paid federal income taxes taxpayers 75000 annual income couples earned 150000 received smaller payments phased income levels rosep peffectively turned child tax credit hrefhttpsreasoncom20210527expandingchildtaxcreditwillnotfightpovertya subsidy paid irsa parents monthly installments boosted payments applied 2021 structural changes child tax credit operates permanentp pfrom july law took effect november year irs distributed 76 billion child welfare payments total 11 billion distributed people qualify payments 37 billion paid 4 million taxpayers qualified according reportp pthat means irs 200 million fraudulent wrong payments month simultaneously staggering total remarkably efficient result government spending programp pcompare pandemicera efforts hrefhttpsreasoncom20210628governmentpandemicloansplaguedbypotential260billioninfraudplagued frauda earlier month federal prosecutors hrefhttpswwwwashingtonpostcombusiness20220920pandemicfraudfoodchildrendojchargeda 47 people connected minnesota nonprofit allegedly stealing 250 million pandemicera federal food program thats largest scheme uncovered date data point constellation wasteful fraudulent pandemicera spendingp pan estimated 10 percent paycheck protection programs hrefhttpswwwcovidmoneytrackerorg820 billiona hrefhttpswwwnbcnewscompoliticsjusticedepartmentbiggestfraudgenerationlootingcovidreliefprogramknownpppn1279664stolen fraudstersa taxpayers ended payinga hrefhttpswwwstlouisfedorgpublicationsregionaleconomist2022julwaspaycheckprotectionprogrameffectiveroughly 4 1 wages benefitsa workers federally boosted unemployment benefits costly mess hrefhttpsreasoncom20220608watchdogreportatleast20percentoffederalpandemicunemploymentdollarswasted20 percent wasteda according government accountability office gao reportmaybe wasteful effort federal aid state local governments hrefhttpsreasoncom20220621federalcovidaidtostatesandlocalitiescost855000perjobsavedtaxpayers dropping 800000 job saveda according national bureau economic research working paperp pthe child welfare payments likely benefited structural arrangements program pervious fraud irs piles data taxpayers dependents years filed tax returns creating new stimulus welfare system cloth boosted child subsidies merely piling money different distribution system existing tax credit eligibility boosted child subsidies based taxpayers 2019 2020 tax returns filed program announcedp pin short goal defraud federal government easier fake company fake unemployment claim fake childp pstill fact program resulted 1 billion wrongful payments months despite structural advantages programs like ppp says federal government tools needs effectively correctly redistribute wealth large pile money going wasted effortp pby reasonable standard 1 billion waste months failure grading government curve makes look like successp pthe post relnofollow hrefhttpsreasoncom20220928irssent11billioninchildwelfarepaymentstothewrongpeopleirs sent 11 billion child welfare payments wrong peoplea appeared relnofollow hrefhttpsreasoncomreasoncomap

6334cca9dfd197b0ed5b42e9

Chomsky: US Must Join Global Call for Negotiations as Russia Escalates Actions

pthe war in ukraine has taken a dramatic turn for the worse putting to rest his own ludicrous claim that the invasion of ukraine constitutes a special military operation russian president vladimir putin has ordered a military callup and staged referendums votes to join russia have been conducted in the occupied territories meanwhile there are calls for more weapons from ukrainian president volodymyr zelenskyy and even demands that russia be removed from the united nations security council the political and military ramifications of these developments are profoundly disturbing says noam chomsky in an exclusive interview for emtruthoutem they indicate a plan for a longdrawnout war of attrition chomsky urges that the us join the rest of the world in calling for negotiations not because putin can be trusted but because negotiations are our best hope for averting disaster theres no certainty as to whether this process would result in peace but as chomsky says there is one and only one way to find out tryp pchomsky is institute professor emeritus in the department of linguistics and philosophy at mit and laureate professor of linguistics and agnese nelms haury chair in the program in environment and social justice at the university of arizona one of the worlds mostcited scholars and a public intellectual regarded by millions of people as a national and international treasure chomsky has published more than 150 books in linguistics political and social thought political economy media studies us foreign policy and world affairs his latest books are emthe secrets of wordsem with andrea moro mit press 2022 emthe withdrawal iraq libya afghanistan and the fragility of us powerem with vijay prashad the new press 2022 and emthe precipiceem emneoliberalism the pandemic and the urgent need for social change emwith cj polychroniou haymarket books 2021p pstrongcj polychroniou seven months after putins criminal invasion of ukraine the war has reached a turning point it has come home to russia with putins call for partial mobilization and annexation referendums have been staged what does the bolstering of russian forces in ukraine mean for russia and ukraine are putins orders for military callup an admission that russia is no longer conducting a special military operation in ukrainestrongp pstrongnoam chomskystrong what has come home to russia is unclear there are reports of protests and forced conscription alongside of appeals to defend mother russia from yet another western invasion which like those [going] back to napoleon will be crushed such appeals might have resonance historical memories may be deep what the outcome will be we can only guessp pfrom the first day it was a criminal invasion never a special military operation but the pretense in the kremlin is still maintained the mobilization is unlikely to have much effect on the war for some time to come and what kind of effect is unclear the failures and incompetence of the russian military have been a continuing surprise to most wellplaced analysts that may well extend to mobilization training and supply of equipment any meaningful bolstering of russian forces from these efforts is likely to be well ahead probably after the winter months i suppose russia could move forces from other regions but whether the leadership has the capability or will to do that i dont knowp pthe mobilization and referenda seem to indicate a plan for a long drawnout war of attrition if the mobilization does succeed in shifting the tide of the war that increases the risks of inducing the west to up the ante with more advanced weapons perhaps reaching to russia itself as president zelenskyy has requested so far rebuffed its not hard to envision scenarios that lead on to catastrophic consequencesp pthats just the beginning the impact of the war goes far beyond to the millions facing starvation with the curtailing of grain and fertilizer exports now partially relieved though there is little information about how much and most important of all and least discussed the sharp reversal of the limited international efforts to address the looming climate crisis a colossal crime against humanityp pwhile huge resources are being wasted in destruction and the fossil fuel industries are gleefully celebrating the opening up of new fields for exploitation to poison the atmosphere even more scientists are regularly informing us that their dire warnings have been far too conservative thus we have recently learned that the middle east region not far away from embattled ukraine is heating a hrefhttpswwwwashingtonpostcomworld20220907middleeastmediterraneanclimatechangealmost twice as fast as the rest of the worlda with an estimated 9f rise by the end of the century and that a hrefhttpswwwhaaretzcomscienceandhealthclimatechange20220920tyarticlemagazinepremiumfacingrapidriseinsealevelsisraelcouldloselargepartsofitscoastline00000183577fd3b0a9bff77f87500000sea levelsa in the eastern mediterranean are expected to rise a meter by midcentury and up to 25 meters by 2100 of course it doesnt stop there the consequences are almost impossible to envisionp pmeanwhile the region continues to be the global center for heating the world to the brink of survivability and soon beyond and while israel and lebanon may soon be sinking into the sea they are squabbling about which will have the honor of virtually destroying both of them by producing the fossil fuels at their maritime borders acts of lunacy duplicated around the world escalating the war in ukraine in the face of such realities reaches levels of imbecility that are hard to capture in wordsp pstrongrussia hopes to annex four occupied regions of ukraine with staged referendums russia used this tactic before in 2014 with the crimean status referendum although the two situations may be quite different the voting in the russianheld donetsk luhansk zaporizhzhia and kherson regions of ukraine is clearly illegal under international law but i suppose this hardly matters to a power that has launched a criminal invasion against an independent country what does russia hope to achieve with the referendums and what happens next especially since russia has had a difficult time so far establishing order in the occupied territoriesstrongp pthe referenda in this case lack any credibility it was different in the case of the crimea referendum in 2014 for one thing the russian takeover of crimea didnt happen in a vacuum for another theres reason to suppose that crimeans looked to russia more than to ukraine though the referenda were not internationally accepted it was recognized by many that the results were not very surprising thats not the case with the current referendap plike the mobilization the staged referenda indicate russian plans for longtime occupation and a war of attrition though they clearly pose another impediment for negotiations over the fate of the regions where they take place they may not completely close the window as anatol lieven a hrefhttpsresponsiblestatecraftorg20220922ticktockputinescalationbeginscountdownofdiplomacyclockdiscussesap pits true that international law means as little to russia as to the other great powers that launch criminal invasions against independent countries the us well in the lead with impunity thanks to its powerp pwhat does russia hope to achieve as weve discussed there are two ways to approach this questionp pone way is to explore the depths of putins mind as george w bush did when he looked into putins eyes saw his soul and pronounced it good and as many amateur psychologists do today with supreme confidencep pa second way is to look at what putin and his associates are saying as in the case of other leaders this may or may not reflect their hidden intentions what matters however is that what they say can be a basis for negotiations if there is any interest in bringing the horrors to an end before they get even worse thats how diplomacy worksp pthe second way suggests that what russia hopes to achieve is primarily neutralization of ukraine and demilitarization and denazification the former means cancellation of the programs of the past years to integrate ukraine de facto within nato that approaches president zelenskyys proposals as recently as last march for neutralization with security guarantees the latter would be a topic for discussion in serious negotiations it might be spelled out as an agreement to refrain from placing heavy weapons aimed at russia in ukraine no further joint military maneuvers etc in short a status rather like mexicop pthose are topics for negotiations if of course there is a serious interest in ending the conflictp pwe might recall that most of the world including a large majority of germans and much of the rest of europe is calling for negotiations now while the us insists that priority must be to severely weaken russia hence no negotiationsp pthere are other issues to be settled primarily crimea and the donbass region an optimal solution would be internationally sponsored referenda on the various options that have been proposed that is presumably not possible now but a serious effort on negotiations might improve the prospects recall that we have a hrefhttpstruthoutorgarticlesnoamchomskythewarinukrainehasenteredanewphasegood evidencea that as recently as last april there were serious ukrainerussia negotiations under turkish auspices and that the usuk opposed themp pas to what happens next that will depend on choices made by those involved primarily ukraine and russia of course but we can hardly pretend to be merely observers from afar see again lievens commentary just citedp plieven is not the only informed analyst who regards peaceful diplomatic settlement as a diminishing but still live option another is a hrefhttpsresponsiblestatecraftorg20220509iledtalksonthedonbasandcrimeainthe1990shereshowthewarshouldendjohn quigleya who has been deeply involved in these issues since the early 90s when he was the us state department representative in the osce [organization for security and cooperation in europe] efforts to resolve contested issues in ukraine after the collapse of the ussr particularly the status of crimea and donbass his special concern we have a hrefhttpstruthoutorgarticlesnoamchomskythehistoricnatosummitinmadridshoredupusmilitarismalready discusseda some of his current thinking as of june 2022p pquigley recognizes that though negotiations are currently stalled at some point however hopefully sooner than later there will be a negotiated settlement that will need to deal with the donbas region in eastern ukraine as well as crimea on crimea he recommends pursuing zelenskyys suggestion that perhaps the two sides could arrange a process of discussion about crimea a process that he said could last 15 years on donbass quigley writes that if ukraine does anything even close to implementing the minsk agreement [the 2015 ukrainerussia agreement under frenchgerman sponsorship which called for a degree of autonomy for donbass within a federal ukraine] russia could say that the aim of its invasion has been accomplished and a settlement could be reachedp ponly a few days ago french president emmanuel macron who has been more closely involved in current negotiation efforts than any other figure expressed somewhat similar views a hrefhttpswwwyoutubecomwatchv1bt5nxdhtooon emcnnema in his opinion at the time of zelenskyys election in 2019 a settlement favorable to ukraine could have been reached along the lines of the minsk agreement he also feels that options for diplomacy remain openp pwhether such assessments are accurate we do not know there is one and only one way to find out try that wont happen quigley concludes if the us goal is less to force russia out of ukraine than to fight russia to the last ukrainian a reasonable assessment he reluctantly commentsp pthat is the one factor in the mix that we can hope to influence something that cannot be emphasized too stronglyp pstrongpresident zelenskyy urged the united nations un to punish russia for its invasion of ukraine by stripping it of its security council veto vote just a few days ago the eu president stronga hrefhttpswwwanewscomtrworld20220923eusmichelcallsforrussiatobesuspendedfromunsecuritycouncilstrongmade similar callsstrongastrong while technically speaking a country can be expelled from the un for persistent violation of the principles of the charter isnt this a misguided proposal isnt it also true that the argument that russia may not even be a member of the un is invalid on account of the fact that the continuation of the ussrs membership by the russian federation which ukraine itself accepted in 1991 is in line with long established procedures within the un strongp pone can easily appreciate president zelenskyys sentiments but whatever the technicalities may be the very fact that the proposal is being seriously considered is enlightening did anyone consider punishing the us in this manner when it invaded iraq to take only one example of its persistent violation of the core principle of the charter that bars the threat or use of force in international affairs with exceptions irrelevant here these violations that are not just persistent but extremely serious matters we need not review even though they are virtually unspeakable in the us mainstreamp pwe should i think keep our minds focused on what should be the central issue for us us policy should we accept the official us position of fighting the war to severely weaken russia precluding diplomatic settlement or should we press the us government to join most of the world including germans and other europeans in seeking a way to end the horrors before they bring further tragedy not only to ukraine but also far beyondp pemthis interview has been lightly edited for clarityemp

pthe war ukraine taken dramatic turn worse putting rest ludicrous claim invasion ukraine constitutes special military operation russian president vladimir putin ordered military callup staged referendums votes join russia conducted occupied territories calls weapons ukrainian president volodymyr zelenskyy demands russia removed united nations security council political military ramifications developments profoundly disturbing says noam chomsky exclusive interview emtruthoutem indicate plan longdrawnout war attrition chomsky urges join rest world calling negotiations putin trusted negotiations best hope averting disaster theres certainty process result peace chomsky says way find tryp pchomsky institute professor emeritus department linguistics philosophy mit laureate professor linguistics agnese nelms haury chair program environment social justice university arizona worlds mostcited scholars public intellectual regarded millions people national international treasure chomsky published 150 books linguistics political social thought political economy media studies foreign policy world affairs latest books emthe secrets wordsem andrea moro mit press 2022 emthe withdrawal iraq libya afghanistan fragility powerem vijay prashad new press 2022 emthe precipiceem emneoliberalism pandemic urgent need social change emwith cj polychroniou haymarket books 2021p pstrongcj polychroniou seven months putins criminal invasion ukraine war reached turning point come home russia putins partial mobilization annexation referendums staged bolstering russian forces ukraine mean russia ukraine putins orders military callup admission russia longer conducting special military operation ukrainestrongp pstrongnoam chomskystrong come home russia unclear reports protests forced conscription alongside appeals defend mother russia western invasion like [going] napoleon crushed appeals resonance historical memories deep outcome guessp pfrom day criminal invasion special military operation pretense kremlin maintained mobilization unlikely effect war time come kind effect unclear failures incompetence russian military continuing surprise wellplaced analysts extend mobilization training supply equipment meaningful bolstering russian forces efforts likely ahead probably winter months suppose russia forces regions leadership capability dont knowp pthe mobilization referenda indicate plan long drawnout war attrition mobilization succeed shifting tide war increases risks inducing west ante advanced weapons reaching russia president zelenskyy requested far rebuffed hard envision scenarios lead catastrophic consequencesp pthats beginning impact war goes far millions facing starvation curtailing grain fertilizer exports partially relieved little information important discussed sharp reversal limited international efforts address looming climate crisis colossal crime humanityp pwhile huge resources wasted destruction fossil fuel industries gleefully celebrating opening new fields exploitation poison atmosphere scientists regularly informing dire warnings far conservative recently learned middle east region far away embattled ukraine heating hrefhttpswwwwashingtonpostcomworld20220907middleeastmediterraneanclimatechangealmost twice fast rest worlda estimated 9f rise end century hrefhttpswwwhaaretzcomscienceandhealthclimatechange20220920tyarticlemagazinepremiumfacingrapidriseinsealevelsisraelcouldloselargepartsofitscoastline00000183577fd3b0a9bff77f87500000sea levelsa eastern mediterranean expected rise meter midcentury 25 meters 2100 course doesnt stop consequences impossible envisionp pmeanwhile region continues global center heating world brink survivability soon israel lebanon soon sinking sea squabbling honor virtually destroying producing fossil fuels maritime borders acts lunacy duplicated world escalating war ukraine face realities reaches levels imbecility hard capture wordsp pstrongrussia hopes annex occupied regions ukraine staged referendums russia tactic 2014 crimean status referendum situations different voting russianheld donetsk luhansk zaporizhzhia kherson regions ukraine clearly illegal international law suppose hardly matters power launched criminal invasion independent country russia hope achieve referendums happens especially russia difficult time far establishing order occupied territoriesstrongp pthe referenda case lack credibility different case crimea referendum 2014 thing russian takeover crimea didnt happen vacuum theres reason suppose crimeans looked russia ukraine referenda internationally accepted recognized results surprising thats case current referendap plike mobilization staged referenda indicate russian plans longtime occupation war attrition clearly pose impediment negotiations fate regions place completely close window anatol lieven hrefhttpsresponsiblestatecraftorg20220922ticktockputinescalationbeginscountdownofdiplomacyclockdiscussesap pits true international law means little russia great powers launch criminal invasions independent countries lead impunity thanks powerp pwhat russia hope achieve weve discussed ways approach questionp pone way explore depths putins mind george w bush looked putins eyes saw soul pronounced good amateur psychologists today supreme confidencep pa second way look putin associates saying case leaders reflect hidden intentions matters basis negotiations interest bringing horrors end worse thats diplomacy worksp pthe second way suggests russia hopes achieve primarily neutralization ukraine demilitarization denazification means cancellation programs past years integrate ukraine de facto nato approaches president zelenskyys proposals recently march neutralization security guarantees topic discussion negotiations spelled agreement refrain placing heavy weapons aimed russia ukraine joint military maneuvers etc short status like mexicop pthose topics negotiations course interest ending conflictp pwe recall world including large majority germans rest europe calling negotiations insists priority severely weaken russia negotiationsp pthere issues settled primarily crimea donbass region optimal solution internationally sponsored referenda options proposed presumably possible effort negotiations improve prospects recall hrefhttpstruthoutorgarticlesnoamchomskythewarinukrainehasenteredanewphasegood evidencea recently april ukrainerussia negotiations turkish auspices usuk opposed themp pas happens depend choices involved primarily ukraine russia course hardly pretend merely observers afar lievens commentary citedp plieven informed analyst regards peaceful diplomatic settlement diminishing live option hrefhttpsresponsiblestatecraftorg20220509iledtalksonthedonbasandcrimeainthe1990shereshowthewarshouldendjohn quigleya deeply involved issues early 90s state department representative osce [organization security cooperation europe] efforts resolve contested issues ukraine collapse ussr particularly status crimea donbass special concern hrefhttpstruthoutorgarticlesnoamchomskythehistoricnatosummitinmadridshoredupusmilitarismalready discusseda current thinking june 2022p pquigley recognizes negotiations currently stalled point hopefully sooner later negotiated settlement need deal donbas region eastern ukraine crimea crimea recommends pursuing zelenskyys suggestion sides arrange process discussion crimea process said 15 years donbass quigley writes ukraine close implementing minsk agreement [the 2015 ukrainerussia agreement frenchgerman sponsorship called degree autonomy donbass federal ukraine] russia aim invasion accomplished settlement reachedp ponly days ago french president emmanuel macron closely involved current negotiation efforts figure expressed somewhat similar views hrefhttpswwwyoutubecomwatchv1bt5nxdhtooon emcnnema opinion time zelenskyys election 2019 settlement favorable ukraine reached lines minsk agreement feels options diplomacy remain openp pwhether assessments accurate know way find try wont happen quigley concludes goal force russia ukraine fight russia ukrainian reasonable assessment reluctantly commentsp pthat factor mix hope influence emphasized stronglyp pstrongpresident zelenskyy urged united nations un punish russia invasion ukraine stripping security council veto vote days ago eu president stronga hrefhttpswwwanewscomtrworld20220923eusmichelcallsforrussiatobesuspendedfromunsecuritycouncilstrongmade similar callsstrongastrong technically speaking country expelled un persistent violation principles charter isnt misguided proposal isnt true argument russia member un invalid account fact continuation ussrs membership russian federation ukraine accepted 1991 line long established procedures un strongp pone easily appreciate president zelenskyys sentiments technicalities fact proposal seriously considered enlightening consider punishing manner invaded iraq example persistent violation core principle charter bars threat use force international affairs exceptions irrelevant violations persistent extremely matters need review virtually unspeakable mainstreamp pwe think minds focused central issue policy accept official position fighting war severely weaken russia precluding diplomatic settlement press government join world including germans europeans seeking way end horrors bring tragedy ukraine far beyondp pemthis interview lightly edited clarityemp

6334ccd8dfd197b0ed5b42ef

OnlySubs: ESG Is for Everyone!

pemonlysubs episode 108 esg is for everyonespan datatagposttitle spanemis now available exclusively for new discourses contributors on the following platformsbr a relnoopener hrefhttpsnewdiscourseslocalscompost2805365esgisforeveryoneonlysubswithjameslindsayep108 target_blanklocalsabr a relnoopener hrefhttpswwwpatreoncompostsesgisforwith72591511 target_blankpatreonabr a relnoopener hrefhttpswwwsubscribestarcomposts709533 target_blanksubscribestarabr a relnoopener hrefhttpsnewdiscoursessubstackcompesgisforeveryone target_blanksubstackabr a relnoopener hrefhttpsyoutube2gkwdqcqfxu target_blankyoutube membersabr a relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesesgisforeveryoneonlysubswithjameslindsayep10891u9njeevent target_blankthinkspotap pesg is a scam the environmental social and governance standards set by some of the most corrupt and powerful institutions on this planet allow them to run the entire professional world like a cartel especially its corporate sector as a result esg is for everyone literally i recently found out that even to work as a server in some restaurants requires people to go through hour upon hour upon hour of iesg trainingi on ones own time unpaid why because the companies cant operate unless they have a good esg score and they cant get a good esg score without forcing everyone within their reach through esg thoughtreform sessions whether they want to or not this compelled fealty to the cartelregime is a violation of our conscience and an insult to our dignity join me on this episode of my subscribersonly podcast james lindsay onlysubs while i rant a little about this coercive indignityp padditional episodes of the emonlysubs podcastem can be found a hrefhttpsnewdiscoursescomtagonlysubshereap pthe post a relnofollow hrefhttpsnewdiscoursescom202209onlysubsesgisforeveryoneonlysubs esg is for everyonea appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap

pemonlysubs episode 108 esg everyonespan datatagposttitlespanemis available exclusively new discourses contributors following platformsbr relnoopener hrefhttpsnewdiscourseslocalscompost2805365esgisforeveryoneonlysubswithjameslindsayep108 target_blanklocalsabr relnoopener hrefhttpswwwpatreoncompostsesgisforwith72591511 target_blankpatreonabr relnoopener hrefhttpswwwsubscribestarcomposts709533 target_blanksubscribestarabr relnoopener hrefhttpsnewdiscoursessubstackcompesgisforeveryone target_blanksubstackabr relnoopener hrefhttpsyoutube2gkwdqcqfxu target_blankyoutube membersabr relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesesgisforeveryoneonlysubswithjameslindsayep10891u9njeevent target_blankthinkspotap pesg scam environmental social governance standards set corrupt powerful institutions planet allow run entire professional world like cartel especially corporate sector result esg literally recently found work server restaurants requires people hour hour hour ofiesg trainingi ones time unpaid companies cant operate good esg score cant good esg score forcing reach esg thoughtreform sessions want compelled fealty cartelregime violation conscience insult dignity join episode subscribersonly podcast james lindsay onlysubs rant little coercive indignityp padditional episodes emonlysubs podcastem found hrefhttpsnewdiscoursescomtagonlysubshereap pthe post relnofollow hrefhttpsnewdiscoursescom202209onlysubsesgisforeveryoneonlysubs esg everyonea appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap

6334cdd4dfd197b0ed5b431a

Open the Skies!

pheres a list of the a hrefhttpswwwcnncomtravelarticleskytraxworldairlineawards2022indexhtmlworlds top ten airlinesap ol liqatar airwaysli lisingapore airlinesimg sizesmaxwidth 647px 100vw 647px srchttpmarginalrevolutioncomwpcontentuploads202209boeing777300erjpg alt width647 srcsethttpmarginalrevolutioncomwpcontentuploads202209boeing777300erjpg 632w httpmarginalrevolutioncomwpcontentuploads202209boeing777300er300x170jpg 300w classwpimage84391 height366li liemiratesli liana all nippon airwaysli liqantas airwaysli lijapan airlinesli liturkish airlinesli liair franceli likorean airli liswiss international air linesli ol pthe airlines in this list have at least two things in common none of worlds best airlines are us owned and none of them are allowed to operate domestically in the united states the two common elements are related because socalled cabotage laws prohibit foreign airlines from serving domestic travelersp pimagine what international travel would be like if you could only fly on a us owned airline ok its not that hard to imagine restricting international flights to domestic airlines would make international travel much more expensive and more inconvenient the us state department rightly lauds the a hrefhttpswwwstategovcivilairtransportagreementsopen skies agreementsa that have brought competition to international flightsp blockquotepsince 1992 the united states has pursued an open skies policy designed to eliminate government intervention in airline decisionmaking about routes capacity and pricing in international marketsopen skies agreements expand cooperative marketing opportunities between airlines liberalize charter regulations improve flexibility for airline operations and commit both governments to high standards of safety and security  they are proconsumer procompetition and progrowth and facilitate countless new cultural links worldwidepblockquote ptrue but us domestic flights fly on closed skies europe has opened up competition to all european airlines indeed europe is also substantially open to us carriers but the us is closed to foreign carriers for domestic flights cabotage laws are in effect a a hrefhttpswwwnytimescom20220909opinionbuyamericanjonesacthtmljones acta for the airlinesp pin an a hrefhttpswwwcatoorgcommentaryhowusairtravelcangetlittleitsgroovebackgood reviewa scott lincicome summarizesp blockquotepeuropes deregulatory experiencesand our ownshow that nixing cabotage restrictions would not only put additional downward pressure on fares but also likely improve route coverage and maybe even customer servicepblockquote pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209opentheskieshtmlopen the skiesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pheres list hrefhttpswwwcnncomtravelarticleskytraxworldairlineawards2022indexhtmlworlds airlinesap ol liqatar airwaysli lisingapore airlinesimg sizesmaxwidth 647px 100vw 647px srchttpmarginalrevolutioncomwpcontentuploads202209boeing777300erjpg alt width647 srcsethttpmarginalrevolutioncomwpcontentuploads202209boeing777300erjpg 632w httpmarginalrevolutioncomwpcontentuploads202209boeing777300er300x170jpg 300w classwpimage84391 height366li liemiratesli liana nippon airwaysli liqantas airwaysli lijapan airlinesli liturkish airlinesli liair franceli likorean airli liswiss international air linesli ol pthe airlines list things common worlds best airlines owned allowed operate domestically united states common elements related socalled cabotage laws prohibit foreign airlines serving domestic travelersp pimagine international travel like fly owned airline ok hard imagine restricting international flights domestic airlines international travel expensive inconvenient state department rightly lauds hrefhttpswwwstategovcivilairtransportagreementsopen skies agreementsa brought competition international flightsp blockquotepsince 1992 united states pursued open skies policy designed eliminate government intervention airline decisionmaking routes capacity pricing international marketsopen skies agreements expand cooperative marketing opportunities airlines liberalize charter regulations improve flexibility airline operations commit governments high standards safety security proconsumer procompetition progrowth facilitate countless new cultural links worldwidepblockquote ptrue domestic flights fly closed skies europe opened competition european airlines europe substantially open carriers closed foreign carriers domestic flights cabotage laws effect hrefhttpswwwnytimescom20220909opinionbuyamericanjonesacthtmljones acta airlinesp pin hrefhttpswwwcatoorgcommentaryhowusairtravelcangetlittleitsgroovebackgood reviewa scott lincicome summarizesp blockquotepeuropes deregulatory experiencesand ownshow nixing cabotage restrictions additional downward pressure fares likely improve route coverage maybe customer servicepblockquote pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209opentheskieshtmlopen skiesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6334cef0dfd197b0ed5b4348

What Western feminists can learn from Iran

pis this it could this finally be the end of the islamic republic of iran as huge crowds of women and men surge through the iranian streets burning hijabs and calling for death to khamenei is an impossible dream finally about to come truep pthe prospects certainly look better a relnoopener hrefhttpswwwbbccouknewsworldmiddleeast63006664 target_blankthan in 2009a when the countrys protestors were primarily middleclass and more narrowly focused on the issue of ahmadinejads election victory rather than on dismantling the oppressive system in its entirety today men and women rural and urban affluent and poor are all marching to bring down the islamic republic khamenei a relnoopener hrefhttpswwwfrance24comenmiddleeast20220925iranayatollahkhameneishealthissuespromptfreshspeculationonsuccession target_blankis also reported to be in very poor healtha so the chants might just come truep pyet senior us officials i have spoken to have cautioned against blind optimism as they explained weve seen many moments in recent iranian history where the tide seemed about to turn only to be disappointed the same officials also warned that america is trying not to become too involved the biden administration isnt supporting the protestors but it isnt explicitly discouraging them eitherp divdiv pthis isnt an example of craven politics i also fear that the end of the regime might not herald a brave new world but rather a bloody mess where khameneis death is followed by internecine fighting for power between various iranian factions would the overthrow of the regime lead to civil war a military coup or liberal democracy nobody knowsp pnone of this is to say that faced with a possible uprising in iran america should avert its gaze perhaps more than anything the wave of protests now sweeping the country is a perfect moment to remind ourselves of the shameful stupidity of us policy in the region in recent years take the 2015 a relnoopener hrefhttpswwwcfrorgbackgrounderwhatirannucleardeal target_blankjcpoa nuclear deala which gave the regime time and space and money to strengthen its morality police and security infrastructure as well as extend its regional influence if no deal had been signed perhaps the regimes current crisis would have come soonerp pnor should we forget the fact that a relnoopener hrefhttpswwwwashingtonpostcomworld20210714iranjournalistkidnappingalinejad target_blankiran has recently trieda to abduct and kill several american citizens on american soil or that a number of senior us officials believe iran is to blame for the attempted assassination of salman rushdie last month its a national disgrace that americas politicians saw fit to break bread with the butchers of tehran in the first place and still too many think we can politely sit down with them again to renegotiate the nuclear deal i wouldnt blame the brave men and women of iran if they never forgave us for such shortsighted idiocyp diva hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnara hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages5418088111300x169jpgadiva hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarh5the infidels will not be silencedh5apa hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarspanbyspan ayaan hirsi aliapdivadiv pstill while the response of the west should be limited to cautious optimism there is one other conclusion we can draw no matter what happens the current protests are a unique and uniquely inspiring phenomenon nowhere else in the muslim world and i mean literally emnowhere elseem would we see what we are seeing right now in iran men and women together standing up for each other the men demanding justice for the regimes murder of a woman who dared to let her hair show it bears repeating the men of iran are standing alongside women as they burn their hijabsp pthis is the most dramatic evidence of something i have long suspected iran is different i have many iranian women friends who are highly accomplished they are doctors and scientists and writers and artists when i ask them how they do it they tell me that they owe much of their success to their male relatives support of their ambitions so perhaps we shouldnt be surprised that the fire behind the protests was lit by mahsa aminis family in particular her father whose remarkable courage in accusing the iranian authorities of a coverup serves as an emblem of the solidarity many iranian men have with their womenp pnow there are caveats to this this phenomenon isnt universal across iran and many iranian women suffer terribly at the hands of their families and some women are even vicious policers of morality but the fact that even emsomeem men behave like this is distinctive in the muslim world and their appearence alongside women in these protests is not a sight that will soon be forgotten in other muslim countries women suffer as much if not more at the hands of their male relatives as at the hands of the authorities men jealously guard womens honour beating imprisoning and even killing their female family members for bringing shame upon the familyp diva hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnara hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarimg srchttpsunherdcomwpcontentuploads2022092gettyimages1227896217scaled1300x200jpgadiva hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarh5schools shouldnt fly blm flagsh5apa hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarspanbyspan ayaan hirsi aliapdivadiv pthis is part of the reason why iran is so unique not only are men standing publicly with women but women must also be emawareem that they are under no threat from their husbands and male relatives otherwise they would not dare put themselves on the front lines like this consider for example a relnoopener hrefhttpswwwbbccouknewsworldmiddleeast63006664 target_blankthe beautiful inspiring videosa of women tossing their headscarves into bonfires before dancing joyously away for all the world to see if they thought their fathers or brothers were waiting back home to punish them i doubt we would see such sights on this scalep pmeanwhile in the west where feminism has proved more successful than anywhere else antimale grievance dominates the mainstream with solidarity between men and women replaced by a desire for polarising identity politics as americas feminist movement collapses under the weight of it its own divisiveness i cant help but find its iranian counterpart far more inspiring men and women standing together speaking up for each others rights how much better this is than the violently womanhating taliban or the petulant privilege of so many western feministsp pin march 1979 just as the ayatollah khomeini came to power the american feminist kate millett travelled to iran to join a protest against his plan to make hijabs compulsory for women the demonstration ultimately proved unsuccessful millett was arrested and expelled from the country iranian women were turned into secondclass citizens yet as we are now discovering their revolutionary spirit was not extinguished iranian feminism has stood the test of time it hasnt been corrupted if only the same could be said for the westp a hrefhttpsunherdcom202209whatwesternfeministscanlearnfromiranappcommentsview 16 commentsa

pis finally end islamic republic iran huge crowds women men surge iranian streets burning hijabs calling death khamenei impossible dream finally come truep pthe prospects certainly look better relnoopener hrefhttpswwwbbccouknewsworldmiddleeast63006664 target_blankthan 2009a countrys protestors primarily middleclass narrowly focused issue ahmadinejads election victory dismantling oppressive system entirety today men women rural urban affluent poor marching bring islamic republic khamenei relnoopener hrefhttpswwwfrance24comenmiddleeast20220925iranayatollahkhameneishealthissuespromptfreshspeculationonsuccession target_blankis reported poor healtha chants come truep pyet senior officials spoken cautioned blind optimism explained weve seen moments recent iranian history tide turn disappointed officials warned america trying involved biden administration isnt supporting protestors isnt explicitly discouraging eitherp divdiv pthis isnt example craven politics fear end regime herald brave new world bloody mess khameneis death followed internecine fighting power iranian factions overthrow regime lead civil war military coup liberal democracy knowsp pnone faced possible uprising iran america avert gaze wave protests sweeping country perfect moment remind shameful stupidity policy region recent years 2015 relnoopener hrefhttpswwwcfrorgbackgrounderwhatirannucleardeal target_blankjcpoa nuclear deala gave regime time space money strengthen morality police security infrastructure extend regional influence deal signed regimes current crisis come soonerp pnor forget fact relnoopener hrefhttpswwwwashingtonpostcomworld20210714iranjournalistkidnappingalinejad target_blankiran recently trieda abduct kill american citizens american soil number senior officials believe iran blame attempted assassination salman rushdie month national disgrace americas politicians saw fit break bread butchers tehran place think politely sit renegotiate nuclear deal wouldnt blame brave men women iran forgave shortsighted idiocyp diva hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnara hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages5418088111300x169jpgadiva hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarspanmore authorspanaa hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarh5the infidels silencedh5apa hrefhttpsunherdcom202208theinfidelswillnotbesilencedrefinnarspanbyspan ayaan hirsi aliapdivadiv pstill response west limited cautious optimism conclusion draw matter happens current protests unique uniquely inspiring phenomenon muslim world mean literally emnowhere elseem seeing right iran men women standing men demanding justice regimes murder woman dared let hair bears repeating men iran standing alongside women burn hijabsp pthis dramatic evidence long suspected iran different iranian women friends highly accomplished doctors scientists writers artists ask tell owe success male relatives support ambitions shouldnt surprised fire protests lit mahsa aminis family particular father remarkable courage accusing iranian authorities coverup serves emblem solidarity iranian men womenp pnow caveats phenomenon isnt universal iran iranian women suffer terribly hands families women vicious policers morality fact emsomeem men behave like distinctive muslim world appearence alongside women protests sight soon forgotten muslim countries women suffer hands male relatives hands authorities men jealously guard womens honour beating imprisoning killing female family members bringing shame familyp diva hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnara hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarimg srchttpsunherdcomwpcontentuploads2022092gettyimages1227896217scaled1300x200jpgadiva hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarspanmore authorspanaa hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarh5schools shouldnt fly blm flagsh5apa hrefhttpsunherdcom202209schoolsshouldntflyblmflagsrefinnarspanbyspan ayaan hirsi aliapdivadiv pthis reason iran unique men standing publicly women women emawareem threat husbands male relatives dare lines like consider example relnoopener hrefhttpswwwbbccouknewsworldmiddleeast63006664 target_blankthe beautiful inspiring videosa women tossing headscarves bonfires dancing joyously away world thought fathers brothers waiting home punish doubt sights scalep pmeanwhile west feminism proved successful antimale grievance dominates mainstream solidarity men women replaced desire polarising identity politics americas feminist movement collapses weight divisiveness cant help find iranian counterpart far inspiring men women standing speaking rights better violently womanhating taliban petulant privilege western feministsp pin march 1979 ayatollah khomeini came power american feminist kate millett travelled iran join protest plan hijabs compulsory women demonstration ultimately proved unsuccessful millett arrested expelled country iranian women turned secondclass citizens discovering revolutionary spirit extinguished iranian feminism stood test time hasnt corrupted said westp hrefhttpsunherdcom202209whatwesternfeministscanlearnfromiranappcommentsview 16 commentsa

6338c00d66f72d44d090cde4

The labor market mismatch model

blockquotepthis paper studies the cyclical dynamics of skill mismatch and quantifies its impact on labor productivity we build a tractable directed search model in which workers differ in skills along multiple dimensions and sort into jobs with heterogeneous skill requirements skill mismatch arises because of information frictions and is prolonged by search frictions estimated to the united states the model replicates salient business cycle properties of mismatch job transitions in and out of bottom job rungs combined with career mobility are key to account for the empirical fit the model provides a novel narrative for the scarring effect of unemploymentpblockquote pthat is a relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101086720461 target_blankfrom the new jpea by isaac baley ana figueiredo and robert ulbricht  follow the science  dont let only the keynesians tell you what is and is not an accepted macroeconomic theoryp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210thelabormarketmismatchmodelhtmlthe labor market mismatch modela appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

blockquotepthis paper studies cyclical dynamics skill mismatch quantifies impact labor productivity build tractable directed search model workers differ skills multiple dimensions sort jobs heterogeneous skill requirements skill mismatch arises information frictions prolonged search frictions estimated united states model replicates salient business cycle properties mismatch job transitions job rungs combined career mobility key account empirical fit model provides novel narrative scarring effect unemploymentpblockquote pthat relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101086720461 target_blankfrom new jpea isaac baley ana figueiredo robert ulbricht follow science dont let keynesians tell accepted macroeconomic theoryp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210thelabormarketmismatchmodelhtmlthe labor market mismatch modela appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6338c0ed66f72d44d090ce00

The forgotten Pilsudski?

blockquotepfor many pilsudskis real significance lay in the role he played in halting a bolshevik conquest of europe in 1920 the british statesman lord dabernon most dramatically expressed this idea when he referred to the 1920 polishsoviet war as one of the eighteen decisive battles of world civilization  the history of contemporary civilization knows no event of greater importance than the battle of warsaw 1920p pin his evaluation of the polish victory in 1920 historian norman davies noted had pilsudski and weygand failed to arrest the triumphant advance of the soviet army at the battle of warsaw not only would christianity have experienced a dangerous reverse but the very existence of western civilization would have been imperiled  and in the field of military history the plan that pilsudski and rozwadowski devised for the battle of warsaw is counted among the twentyfive wars in world history revealing tactical genius in battlepblockquote pthat is from the new and very useful book a relnoopener hrefhttpswwwamazoncomjozefpilsudskifoundingfathermoderndp0674984277refsr_1_3cridmziictj9coc5keywordsjoshuadzimmermanqid1664589202queyjxc2mioiiwljgxiiwicxnhijoimc45nyisinfzcci6ijaumdaifq3d3dsprefixjoshuadzi2caps2c119sr83 target_blankjozef pilsudski founding father of modern polanda by joshua d zimmerman  here is a relnoopener hrefhttpsenwikipediaorgwikipolishe28093soviet_war target_blankwikipedia on the polishsoviet warap pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210theforgottenpilsudskihtmlthe forgotten pilsudskia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

blockquotepfor pilsudskis real significance lay role played halting bolshevik conquest europe 1920 british statesman lord dabernon dramatically expressed idea referred 1920 polishsoviet war eighteen decisive battles world civilization history contemporary civilization knows event greater importance battle warsaw 1920p pin evaluation polish victory 1920 historian norman davies noted pilsudski weygand failed arrest triumphant advance soviet army battle warsaw christianity experienced dangerous reverse existence western civilization imperiled field military history plan pilsudski rozwadowski devised battle warsaw counted twentyfive wars world history revealing tactical genius battlepblockquote pthat new useful book relnoopener hrefhttpswwwamazoncomjozefpilsudskifoundingfathermoderndp0674984277refsr_1_3cridmziictj9coc5keywordsjoshuadzimmermanqid1664589202queyjxc2mioiiwljgxiiwicxnhijoimc45nyisinfzcci6ijaumdaifq3d3dsprefixjoshuadzi2caps2c119sr83 target_blankjozef pilsudski founding father modern polanda joshua d zimmerman relnoopener hrefhttpsenwikipediaorgwikipolishe28093soviet_war target_blankwikipedia polishsoviet warap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210theforgottenpilsudskihtmlthe forgotten pilsudskia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

633b63dfac2a211da51ffc6d

Kwasi Kwarteng’s speech only revealed his contradictions

pit wasnt supposed to be like this in his first conservative conference speech as chancellor a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagkwasikwarteng target_blankkwasi kwartenga wanted to double down on his budget and set out a vision for a growing thriving economy but since its announcement ten days ago a poor market reaction and soaring borrowing costs have diminished the chancellors reputation so much so that this morning 3 october he dismantled a key pillar of the budget the abolition of the 45p top rate of taxp pnonetheless kwartengs speech made clear that he would continue in the same vein he acknowledged there had been a little turbulence in recent days but said we need to focus on the job in hand we need to move forward no more distractions is the a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankbank of englandas emergency 65bn intervention last week a mere distractionp pthis was a speech riddled with contradictions kwarteng sauntered towards the podium with a jaunty confidence but then his delivery was nervous he compared the governments growth plan to the industrial revolution but then spoke about tax cuts not industry and infrastructure he recommitted to reducing government debt as a share of gdp in the medium term but wouldnt explain how that will happen he said his plans would lead to more money for public services but wouldnt increase publicservice budgets in line with a relnoreferrer noopener hrefhttpswwwnewstatesmancomtaginflation target_blankinflationa potentially costing them 18bn a year p pstill trying to blame todays problems on the last labour government kwarteng said the conservatives had reversed a story of national decline but then said his policies were necessary because after 12 years of tory rule the path ahead of us was one of slow managed decline which is itp pthe atmosphere in the conference hall was stunted nervous standing ovations came hesitantly the applause was sparse after the unexpected announcements in the budget there was a sense kwarteng could produce another surprise absolutely anything is possible the chancellor said at one point the sweat sparkling on his head yes that is part of the problemp pstrongem[see also a hrefhttpswwwnewstatesmancomcomment202210liztrussworstconservativeprimeministeryetliz truss has already proved to be the worst conservative prime minister yet]aemstrongp

pit wasnt supposed like conservative conference speech chancellor relnoreferrer noopener hrefhttpswwwnewstatesmancomtagkwasikwarteng target_blankkwasi kwartenga wanted double budget set vision growing thriving economy announcement days ago poor market reaction soaring borrowing costs diminished chancellors reputation morning 3 october dismantled key pillar budget abolition 45p rate taxp pnonetheless kwartengs speech clear continue vein acknowledged little turbulence recent days said need focus job hand need forward distractions relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankbank englandas emergency 65bn intervention week mere distractionp pthis speech riddled contradictions kwarteng sauntered podium jaunty confidence delivery nervous compared governments growth plan industrial revolution spoke tax cuts industry infrastructure recommitted reducing government debt share gdp medium term wouldnt explain happen said plans lead money public services wouldnt increase publicservice budgets line relnoreferrer noopener hrefhttpswwwnewstatesmancomtaginflation target_blankinflationa potentially costing 18bn yearp pstill trying blame todays problems labour government kwarteng said conservatives reversed story national decline said policies necessary 12 years tory rule path ahead slow managed decline itp pthe atmosphere conference hall stunted nervous standing ovations came hesitantly applause sparse unexpected announcements budget sense kwarteng produce surprise absolutely possible chancellor said point sweat sparkling head yes problemp pstrongem[see hrefhttpswwwnewstatesmancomcomment202210liztrussworstconservativeprimeministeryetliz truss proved worst conservative prime minister yet]aemstrongp

633b6459ac2a211da51ffc7c

Matt Yglesias discusses populations as infrastructure on Beneath the Surface

pon a recent episode of beneath the surface matthew yglesias discussed populations as a type of infrastructure you can listen to the full episode herep iframe width400px srchttpsanchorfmtheniskanencenterembedepisodesmattyglesiasdiscussespopulationsasinfrastructureonbeneaththesurfacee1oka2b height102pxiframe pphoto credit a hrefhttpswwwistockphotocomphotonewyorkcityskylinegm918150270252572753clarityfalseistockap pthe post a relnofollow hrefhttpswwwniskanencenterorgmattyglesiasdiscussespopulationsasinfrastructureonbeneaththesurfacematt yglesias discusses populations as infrastructure on beneath the surfacea appeared first on a relnofollow hrefhttpswwwniskanencenterorgniskanen centerap

pon recent episode beneath surface matthew yglesias discussed populations type infrastructure listen episode herep iframe width400px srchttpsanchorfmtheniskanencenterembedepisodesmattyglesiasdiscussespopulationsasinfrastructureonbeneaththesurfacee1oka2b height102pxiframe pphoto credit hrefhttpswwwistockphotocomphotonewyorkcityskylinegm918150270252572753clarityfalseistockap pthe post relnofollow hrefhttpswwwniskanencenterorgmattyglesiasdiscussespopulationsasinfrastructureonbeneaththesurfacematt yglesias discusses populations infrastructure beneath surfacea appeared relnofollow hrefhttpswwwniskanencenterorgniskanen centerap

633b647cac2a211da51ffc84

Valuing the Deep State Part IV: Why Delegation is Necessary

img altvaluing the deep state part iv why delegation is necessary srchttpswwwamericanpurposecomcontentimages202210fedjpgpemfourth article in a series on bureaucratic autonomy the first installment can be found a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea the second a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea and the third a hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea you can also watch a video version of this article hereembrpfigureiframe allowfullscreen srchttpswwwyoutubecomembedtgctfnwcgssfeatureoembed width200 titleon delegation blog 01 height113iframefigurepbefore we can get into an analysis of the pathologies of the deep state and of the pathologies of the current conservative attack on it we need to talk a bit more on an abstract level about why delegation is necessary in any hierarchical organization and why some degree of bureaucratic autonomy is therefore necessaryppin democratic theory legitimate authority comes from the people who are sovereign and have the ultimate right to make political decisions they vote for legislators and if they have a presidential system a president with equal democratic legitimacy these elected officials then go on to empower a bureaucracy to carry out their willppthose bureaucrats are in theory simply mechanical agents whose only job is to carry out the mandates imposed by their political superiors the principalagent theory used by economists maintains that dysfunctions in hierarchical systems like corruption arise when the agents follow their own interests rather than simply carrying out the mandates of their principals___steady_paywall___ppanyone who has studied realworld bureaucracy however knows that this is a highly oversimplified view of things the great herbert simon in his classic work on public administration noted that authority in organizations often flows in the opposite direction from agents to principals because the bureaucratic agents often have greater expertise and knowledge of conditions on the ground than their political principalsppwe can illustrate this with regard to military organization and the war that is currently playing out in ukraine the worlds most effective military organizations delegate huge amounts of authority to the lowest possible command levels because it is those junior officers in contact with the enemy that understand best the threats and opportunities they face this was true of the german army in world war ii the israeli defense forces and the contemporary us armyppthe latter in its postvietnam reorganization adopted the german practice of emauftragstaktikem under the heading of mission orders or commanders intent where senior commanders were taught to delegate authority down the chain of command and avoid micromanagement you can read about this in the last study i completed for the rand corporation ema hrefhttpswwwrandorgpubsmonograph_reportsmr863htmlthe virtual corporation and army organizationaem written with abram shulsky back in 1997 this was codified in fm 1005 the armys combined arms manual and taught in us staff schools the superiority of this approach was amply demonstrated during the two gulf wars and is the practice that has been taught to the ukrainians in the period following the annexation of crimea  pfigureimg sizesminwidth 720px 720px srchttpswwwamericanpurposecomcontentimages202210fm1005jpg altvaluing the deep state part iv why delegation is necessary width730 srcsethttpswwwamericanpurposecomcontentimagessizew600202210fm1005jpg 600w httpswwwamericanpurposecomcontentimages202210fm1005jpg 730w height945figurepthe russian military by contrast adheres to a rigid hierarchical system in which senior officers fail to delegate authority and are themselves directed from above there are reports that vladimir putin has himself taken to giving operational orders to his own military much as saddam hussein did during the gulf wars this centralized system has led to disastrous results as local russian officers are unable to respond to rapidly changing developments on the groundppthis military example illustrates a broader truth about all hierarchies principals mandate broad strategic directions but the actual work of the organization is often done by lowerlevel agents acting on their own authority all organizations in human history have had to balance the need for political control against the requirements of bureaucratic autonomyppat some point in the late 1990s it hit me that the central issue in all administrative theoryand therefore in politics itselfwas the problem of delegated discretion i have been thinking about this problem ever sinceppthe need for delegated authority applies to the us government writ large bureaucratic autonomy is widespread and necessary for the government to function given the need for expertise and local knowledge thomas koenig recently a hrefhttpswwwamericanpurposecomarticlesdemocracycantbedelegatedwrote in these pagesa about the constitutions nondelegation clause echoing arguments of many conservative critics of the administrative state it is a nice vision of an american democracy of the people for the people and by the people that citizens through their elected representatives should deliberate on policies and retain the broadest possible control over decisionmaking but this is a very nave view of how contemporary american government functions and runs up against two big obstaclesppthe first has to do with expertise back in the 1820s the main functions of american government were collecting customs duties and delivering the mail andrew jackson may have been right at that time that any ordinary american could perform these tasks though even then when most citizens had at most an elementary school education this might have been hardits hard to read a postal address if youre illiterate today the us government does things like model the weather manage the flow of funds through an incredibly complex financial system operate national laboratories and fund scientific research allocate spectrum send spacecraft to the moon and beyond and protect the health of its 330 million citizens these are not functions that ordinary citizens or their elected representatives know terribly much about or have time to deliberate what they can do is set broad mandates regarding the outcomes that their agencies are expected to achieve do we want congress to be debating how many parts per million of a list of thousands of toxins are acceptable or what specific changes boeing must make in its manufacturing process to keep its airliners safe the united states like most other advanced countries has granted substantial autonomy to its central bank the federal reserve precisely because we do emnot emwant elected politicians to be setting interest ratesppthe need for bureaucratic expertise can be illustrated by examples from early 20supthsup century administrative law many us states and municipalities sought to regulate electric utilities and railroads that were exercising monopoly power in their jurisdictions they needed to establish a reasonable rate of return that would protect consumers but yet keep the utilities economically viable but what constituted a reasonable rate legislatures found they couldnt set these nor did the courts have the economic expertise to do so so the function was necessarily delegated to expert regulatory agenciesppthe second big problem with a doctrinaire attachment to nondelegation has to do with the legislative process itself it is not as if the us congress is a highly effective deliberative body that is able to come up with wise solutions to pressing national problems it was always the case that democratic legislatures do not make the best decisions after the civil war many states mandated racial segregation and created a system that could be dismantled only through the exercise of federal power congress performance has only deteriorated over time it is captured by powerful interest groups and increasingly polarized in ways that prevent it from performing its most basic functions like passing budgets under regular order with the politicization of virtually every issue coming before it the idea that congress could issue clear mandates on for example how to deal with carbon emissions or regulate large internet platforms is rather fanciful the default outcome is congressional inaction which leaves a vacuum to be filled by courts and bureaucraciesppthis is not to say that these unelected bodies can legitimately make policy on their own there are plenty of examples of judicial and bureaucratic overreach which i will discuss in a subsequent post it would be very nice if the us congress stepped up to its responsibilities and issued clear mandates on how the country was to deal with carbon emissions immigration and asylum policy digital speech and any number of other pressing issues but congress has never been in the business of issuing clear mandates to its bureaucratic agents and is unlikely to do so in the near future into this breech have stepped bureaucracies and courts to try to sort out the confused or absent mandates set by congress the question is therefore not a categorical rejection of delegation but a proper setting of a balance between legislative control and bureaucratic autonomyppin the next post i will explain how political principals have controlled bureaucratic agents in the united states over time and what the conservative attack on the administrative state portends for the futurep

img altvaluing deep state iv delegation necessary srchttpswwwamericanpurposecomcontentimages202210fedjpgpemfourth article series bureaucratic autonomy installment found hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea second hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea watch video version article hereembrpfigureiframe allowfullscreen srchttpswwwyoutubecomembedtgctfnwcgssfeatureoembed width200 titleon delegation blog 01 height113iframefigurepbefore analysis pathologies deep state pathologies current conservative attack need talk bit abstract level delegation necessary hierarchical organization degree bureaucratic autonomy necessaryppin democratic theory legitimate authority comes people sovereign ultimate right political decisions vote legislators presidential system president equal democratic legitimacy elected officials empower bureaucracy carry willppthose bureaucrats theory simply mechanical agents job carry mandates imposed political superiors principalagent theory economists maintains dysfunctions hierarchical systems like corruption arise agents follow interests simply carrying mandates principals___steady_paywall___ppanyone studied realworld bureaucracy knows highly oversimplified view things great herbert simon classic work public administration noted authority organizations flows opposite direction agents principals bureaucratic agents greater expertise knowledge conditions ground political principalsppwe illustrate regard military organization war currently playing ukraine worlds effective military organizations delegate huge amounts authority lowest possible command levels junior officers contact enemy understand best threats opportunities face true german army world war ii israeli defense forces contemporary armyppthe postvietnam reorganization adopted german practice emauftragstaktikem heading mission orders commanders intent senior commanders taught delegate authority chain command avoid micromanagement read study completed rand corporation ema hrefhttpswwwrandorgpubsmonograph_reportsmr863htmlthe virtual corporation army organizationaem written abram shulsky 1997 codified fm 1005 armys combined arms manual taught staff schools superiority approach amply demonstrated gulf wars practice taught ukrainians period following annexation crimea pfigureimg sizesminwidth 720px 720px srchttpswwwamericanpurposecomcontentimages202210fm1005jpg altvaluing deep state iv delegation necessary width730 srcsethttpswwwamericanpurposecomcontentimagessizew600202210fm1005jpg 600w httpswwwamericanpurposecomcontentimages202210fm1005jpg 730w height945figurepthe russian military contrast adheres rigid hierarchical system senior officers fail delegate authority directed reports vladimir putin taken giving operational orders military saddam hussein gulf wars centralized system led disastrous results local russian officers unable respond rapidly changing developments groundppthis military example illustrates broader truth hierarchies principals mandate broad strategic directions actual work organization lowerlevel agents acting authority organizations human history balance need political control requirements bureaucratic autonomyppat point late 1990s hit central issue administrative theoryand politics itselfwas problem delegated discretion thinking problem sinceppthe need delegated authority applies government writ large bureaucratic autonomy widespread necessary government function given need expertise local knowledge thomas koenig recently hrefhttpswwwamericanpurposecomarticlesdemocracycantbedelegatedwrote pagesa constitutions nondelegation clause echoing arguments conservative critics administrative state nice vision american democracy people people people citizens elected representatives deliberate policies retain broadest possible control decisionmaking nave view contemporary american government functions runs big obstaclesppthe expertise 1820s main functions american government collecting customs duties delivering mail andrew jackson right time ordinary american perform tasks citizens elementary school education hardits hard read postal address youre illiterate today government things like model weather manage flow funds incredibly complex financial system operate national laboratories fund scientific research allocate spectrum send spacecraft moon protect health 330 million citizens functions ordinary citizens elected representatives know terribly time deliberate set broad mandates outcomes agencies expected achieve want congress debating parts million list thousands toxins acceptable specific changes boeing manufacturing process airliners safe united states like advanced countries granted substantial autonomy central bank federal reserve precisely emnot emwant elected politicians setting interest ratesppthe need bureaucratic expertise illustrated examples early 20supthsup century administrative law states municipalities sought regulate electric utilities railroads exercising monopoly power jurisdictions needed establish reasonable rate return protect consumers utilities economically viable constituted reasonable rate legislatures found couldnt set courts economic expertise function necessarily delegated expert regulatory agenciesppthe second big problem doctrinaire attachment nondelegation legislative process congress highly effective deliberative body able come wise solutions pressing national problems case democratic legislatures best decisions civil war states mandated racial segregation created system dismantled exercise federal power congress performance deteriorated time captured powerful interest groups increasingly polarized ways prevent performing basic functions like passing budgets regular order politicization virtually issue coming idea congress issue clear mandates example deal carbon emissions regulate large internet platforms fanciful default outcome congressional inaction leaves vacuum filled courts bureaucraciesppthis unelected bodies legitimately policy plenty examples judicial bureaucratic overreach discuss subsequent post nice congress stepped responsibilities issued clear mandates country deal carbon emissions immigration asylum policy digital speech number pressing issues congress business issuing clear mandates bureaucratic agents unlikely near future breech stepped bureaucracies courts try sort confused absent mandates set congress question categorical rejection delegation proper setting balance legislative control bureaucratic autonomyppin post explain political principals controlled bureaucratic agents united states time conservative attack administrative state portends futurep

633b65a4ac2a211da51ffcb0

Liz Truss has betrayed conservatism

pthe past few weeks have been a liminal period in british politics one in which we have been presented with real political choices for the first time in a long time the great spectacle of the royal funeral achieved what state funerals are expressly designed to do reassert the unity of the british nation in a shared sacral ritual of belonging beyond sterile rationality as the tribe interred its fallen chief with great pomp and ceremony but more the fundamental contours of british politics were exposed by the nearsimultaneous accession of both the king and liz trussp pin king charles we have a relnoopener hrefhttpsunherdcom202209themythicpowerofkingcharlesiii target_blanka postliberal monarcha who furiously rejects the marketisation of ever more aspects of human life there are in his writings elements of the a hrefhttpswwwjstororgstable441444tietjens toryisma of ford madox fords emparades endem whereby the paternalistic concern of the central character the last surviving tory for social harmony and widespread prosperity delineate the point at which the high toryism of tietjens [meets] the extreme radicalism of the extreme left of the leftp pyet on the other baleful side of the ledger we have been foisted with a career politician who seems to view the laziest leftwing caricatures of toryism as a political roadmap a pure zealot of unrestrained capital with no vision of the good beyond libertarian think tank pamphlets and a burning faith in the might and power of the markets invisible hand alas trusss faith in the markets is not rewarded by the markets faith in her the invisible hand has already reached down to flick her from the history booksp divdiv pher plan for massive borrowing relied on the faith of international opinion that it would be amply repaid by her simultaneous tax cuts for britains very richest and an economic boom occasioned by vague promises of future reforms to pay for her budget and for its unintended consequences the government now looks a hrefhttpswwwftcomcontentb2b69e74311a46ffa1c481b1880fd6f8set to slash spendinga on the infrastructure and research and development projects on which longterm prosperity depends unfortunately for truss and for the country the international markets the imf the bank of england and those notorious leftwing radicals the ema hrefhttpswwwftcomcontentf1f27816b0ca4b66a8fecce74c3b0af2financial timesaem and a relnoopener hrefhttpswwweconomistcomleaders20220928hownottorunacountry target_blankthe emeconomistemaem emrecoiled in horror when even the emtelegraphem a relnoopener hrefhttpswwwtelegraphcoukbusiness20220929liztrussembarkedcoursesheermadnesstakingbankengland1 target_blankwarnsa that the peronist policies of a a careless ideological government set on a course of sheer madness put this country in serious jeopardy we can be certain that we are in a new era there are fashions in economics as in all things outside the conservative party the rest of the world has a relnoopener hrefhttpswwwcsisorganalysisshockandincredulitywhymarketsdontbuynewbritishgovernmentsgrowthplan target_blankfirmly rejecteda the seventies dogmas that brought britain a relnoopener hrefhttpsunherdcom202102theideologythatbrokebritain target_blankdecades of stagnation and underinvestmenta  even in a far rosier international climate than the one we currently inhabitp pit is like the story of ema relnoopener hrefhttpsenwikipediaorgwikithe_monkey27s_paw target_blankthe monkeys pawaem after so long demanding a conservative leader committed to bold and decisive action the one the party chose was a suicide bomber the only questions now surely are how much harm she can cause the country in the time remaining and whether she will bring down the conservative party with her because truss forgot that the british public also has a vote dreading an economic winter harder than anyone has previously experienced the voting public looks to have decisively rejected trussonomics and will deliver labour the greatest parliamentary majority a relnoopener hrefhttpstwittercomvalen10francoisstatus1575548551660118016s20takpmctxfu79kjugs1nbh1q target_blankin british political historya the story of the past few years from brexit to the 2019 conservative landslide and now labours coming victory is of a british public desirous of radical change and of a political class struggling to comprehend what this means let alone how to deliver it the conservatives were elected on a simple mandate to reform britains failing economic model and slash our current a relnoopener hrefhttpswwwtelegraphcouknews20220930massmigrationmuchbiggerproblemtorieseconomy target_blankrecordhigh levels of immigrationa instead truss is doubling down on bothp pit is a matter of great cosmic irony that in the same week truss lost the red wall with a platform encapsulating everything the brexit vote was against keir starmer won it back a relnoopener hrefhttpsunherdcomthepostkeirstarmerfinallygoesbluelabour target_blankwith a postliberal messagea centred on direct investment in state capacity public services and home ownership through the simplest supply side reform housebuilding the libertarian think tanks a hrefhttpstwittercommrharrycolestatus1573254916918988800s20toxlcqjemfzqx_bbaohkq9wwho so gleefully rushed to take ownershipa of her budget when it was announced must now take ownership of the results they have destroyed the party they have hollowed out and stripped of any vestiges of tory thinkingp pthough a disaster for the conservative party the minibudget was apparently a hrefhttpstwittercommontiestatus1574759025438326785s20toxlcqjemfzqx_bbaohkq9wa triumph for the ieaa the freemarket think tank which has long advanced this ideology as well as having groomed truss and kwarteng and as the party has been warned time and time again what they have cooked up is a relnoopener hrefhttpstwittercomproftimbalestatus1575756143401394176s20takpmctxfu79kjugs1nbh1q target_blankas repellent to ordinary votersa as it is to traditionalist toriesp diva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnara hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages52101073scalede16627447474831300x169jpgadiva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspansuggested readingspanaa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarh5the mythic power of king charles iiih5apa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanbyspan aris roussinosapdivadiv pthe ideologues have crashed britain and the conservative party into a cliff and the party now requires time out of office to relearn toryism from first principles shorn of the libertarian accretions that have driven it to chaos and the edge of extinction the wreckers must be entirely driven out from british conservatism in whose stolen clothes they have made mischief for far too long but until then there is no tory case for voting for the conservative party a party that puts its own shortterm survival above the national interest has no business running a countryp pit is the tragic irony of british conservatism in 2022 that just as the only reason to now vote tory is to own the cons like the ieas julian jessop and kristian niemitz a relnoopener hrefhttpstwittercomk_niemietzstatus1573967083347517443s20toxlcqjemfzqx_bbaohkq9w target_blankwelcoming trusss push for massively increased immigrationa so does the only means of restraining the selfdestructive zealotry of the economic liberals now seem to lie within the labour party some of the warmest responses to starmers conference speech in which he warned that decline is not inevitable and promised that the labour party is now the party of reindustrialisation national selfreliance home ownership and support for ordinary people came from a relnoopener hrefhttpstwittercommontiestatus1574759025438326785s20toxlcqjemfzqx_bbaohkq9w target_blanktory commentatorsa a relnoopener hrefhttpstwittercomtimothy_stanleystatus1574768061974020096s20toxlcqjemfzqx_bbaohkq9w target_blankaghast at trusss radical liberal visionap pit is those tories representing the partys paternalist social conscience who have been most struck by the contrast between trusss wrecking ball and starmers softly postliberal vision for as gavin rice of the conservative centre for social justice think tank a relnoopener hrefhttpstwittercomgavinantonyricestatus1574759942644539396s20toxlcqjemfzqx_bbaohkq9w target_blankobservesa starmer just laid out a postliberal brexit controlled immigration pride in community democratic control buying making and selling more in britain and the potential of active government tories shouldnt be allowing them to control this turf but this is the path they chose and when the voters punish for them for it the party only has itself to blamep pit is remarkable to observe that trusss mentors in the iea still found time to release a paper a hrefhttpsunherdcomwpcontentuploads202209takinglibertiespdfemtaking liberties why postliberals are wrong about personal freedomem by jamie whytea  denouncing the rival postliberal trend in conservative thought the very same political philosophy whose faintest echoes have rewarded labour with the prospect of a historic landslide the paper did not gain much traction true it was a poorly argued mishmash of philosophical sophistry against an amalgamated strawman version of very distinct political tendencies but that they thought it necessary to release is in itself indicative of where the intellectual energy now lies within conservatism on both sides of the atlanticp diva hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnara hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarimg srchttpsunherdcomwpcontentuploads202207gettyimages12419603421scalede1658248409661300x173jpgadiva hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarh5kemi badenoch has saved the toriesh5apa hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarspanbyspan aris roussinosapdivadiv pyet the paper presents a fascinating insight into the worldview of a crankish doctrine the british public so visibly and overwhelmingly rejects throughout the author rejects any notion of a common good the essential building block of both modern postliberalism and traditional toryism associating the idea with compulsion at the hands of the state so the author writes postliberals believe politicians should take a view about the good life specifically the postliberals traditionalist view and use the powers of the state to make sure that people live it in what he describes as a proposed wayof life authoritarianism and a regime in which politicians use state power to make them live the good lifep pto reach this conclusion the author conflates the two very different american and british postliberal strands of thought currently at war with each other through a heated exchange of open letters in the emamerican conservativeem he adopts the framing of the harderedged american postliberalisms vision of the catholicadministrative state to condemn british postliberalism which is in truth a conservative variant of socialism infused with a traditionalist tory discomfort with modernity and drawn from our nations distinct historical path british postliberals like other social democrats do indeed believe that the nations good as well as prosperity would be enhanced if everyone were to be given support by the state to settle down form families and own their own homes this is or was a hrefhttpsunherdcom202207britainneedsmacmillannotthatchera very basic tenet of toryism tooa but this is quite a different thing from state compulsion there will be no roaming squads of tweedjacketed postliberals forcing otherwise happy singletons to marry and frogmarching them into suburban semisp pbut then even this very basic expression of the common good is a vision of hell to the radical iea liberal who warns that policies that cause more people to marry perhaps by way of tax incentives can still harm them for being in a good and sound marriage involves forgoing other sources of happiness john might also gain happiness from travelling the world alone or from seducing strangers at nightclubs indeed he might yet reordering the british economy and the lives and prosperity of the british people around our hypothetical johns mission of global seduction is simply not conservatism in any form and a party that can prioritise this philosophy over the national good fully deserves the disaster coming its wayp pbut even as the paper asserts that the postliberal claim that liberalism leads to social atomisation and the construction of obstacles to the formation of family life is false it argues against state support for those who wish to do so in the seeming belief that helping those who wish for a secure and settled domesticity to attain it will somehow impinge on johns absolute freedom we should be clear a postliberal government would not prevent john or other liberals doing as they wished with their own lives it would instead simply support those who wished for the very basic goods of home ownership and domestic comfort and security to attain them yet even this is apparently anathema to the iea and we must now sadly assume to our own notionally conservative governmentp diva hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnara hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarimg srchttpsunherdcomwpcontentuploads202202gettyimages1064754862300x205jpgadiva hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarspansuggested readingspanaa hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarh5boris johnsons squandered chanceh5apa hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarspanbyspan aris roussinosapdivadiv pcoercion by global market forces is simply no liberation it is this exact vision of the entirety of social life from the family to the nation being subject to and torn apart by the destructive power of the unrestrained market that postliberals as well as british voters reject and it is precisely this outcome which liberals in their purest form like truss and the think tanks which formed her worldview try to summon into being through ever more painful rites of destruction and selfsacrifice if earthly salvation has not yet been attained then ever more of what society holds good must be hurled onto the flames this is neither politics nor economics but the frustrated religious impulse that drives all liberalismp plike communists who wave away the misery and destruction every attempt to apply their vision in practice has so far entailed free market fundamentalists like a relnoopener hrefhttpswwwnewstatesmancompoliticsconservatives202209liztrussrisemarketmillennialsfreemarketideology target_blanktruss and the think tanks around hera assert that the only problem with their failed vision is that it has never yet been properly applied instead guided by tory pragmatism postliberalism rejects fantastical visions of the future in favour of a future partly shaped by the forms of social and economic life that existed before capitalism a world which was far from perfect but whose failings are known and therefore capable of being effectively amelioratedp pbut as it stands there is no home for postliberal tories always wary of the free market as a force destructive to tradition and social order in the conservative party that now exists instead we must be grateful that when given free rein the libertarians have discredited their doctrine as electoral poison in a few short and tumultuous days just like the state funeral trusss accession was itself a great symbolic moment it marked the nadir of tietjens toryism as a philosophical tradition within the conservative party and the total victory of a radical form of economic liberalism which like an alchemist turning gold into lead has transmuted 2019s electoral landslide into disaster if any tory case can be made for truss it is a purely accelerationist one that the catastrophe she has brought in tow may finally exorcise thatchers unquiet ghost and allow the party or whatever form of conservative politics succeeds the party that put her into power against so many warnings to reflect upon what toryism actually meansp pbut until then it is starmers labour which learned the lessons of brexit and 2019 that has rejected radical economic liberalism and pledged to deliver the common good certainly there is still space for him to lose just as the conservatives failed to restrain their economic liberal extremists so must starmer restrain the extremist social liberals in labours ranks whose views the ordinary voter deems equally strange and repulsive but on basic bread and butter policy the contrast between a labour party pledging to build more homes and a conservative government about to lose many britons the homes they already own is absolutep pif they achieve just this one aim let alone their promises to deliver a brexit that works for the entire country or to return manufacturing capacity to british shores through state investment then labour deserves to win the landslide victory the conservatives a relnoopener hrefhttpswwwspectatorcoukarticlewhatdothetorieshavetoshowfromtheirtimeinpower target_blankchose to squandera in choosing truss the conservative party chose to make the tory case for labourp a hrefhttpsunherdcom202210liztrusshasbetrayedconservatismappcommentsview 23 commentsa

pthe past weeks liminal period british politics presented real political choices time long time great spectacle royal funeral achieved state funerals expressly designed reassert unity british nation shared sacral ritual belonging sterile rationality tribe interred fallen chief great pomp ceremony fundamental contours british politics exposed nearsimultaneous accession king liz trussp pin king charles havea relnoopener hrefhttpsunherdcom202209themythicpowerofkingcharlesiii target_blanka postliberal monarchawho furiously rejects marketisation aspects human life writings elements thea hrefhttpswwwjstororgstable441444tietjens toryismaof ford madox fordsemparades endem paternalistic concern central character surviving tory social harmony widespread prosperity delineate point high toryism tietjens [meets] extreme radicalism extreme left leftp pyet baleful ledger foisted career politician view laziest leftwing caricatures toryism political roadmap pure zealot unrestrained capital vision good libertarian think tank pamphlets burning faith power markets invisible hand alas trusss faith markets rewarded markets faith invisible hand reached flick history booksp divdiv pher plan massive borrowing relied faith international opinion amply repaid simultaneous tax cuts britains richest economic boom occasioned vague promises future reforms pay budget unintended consequences government looksa hrefhttpswwwftcomcontentb2b69e74311a46ffa1c481b1880fd6f8set slash spendingaon infrastructure research development projects longterm prosperity depends unfortunately truss country international markets imf bank england notorious leftwing radicals theema hrefhttpswwwftcomcontentf1f27816b0ca4b66a8fecce74c3b0af2financial timesaemanda relnoopener hrefhttpswwweconomistcomleaders20220928hownottorunacountry target_blanktheemeconomistemaememrecoiled horror theemtelegraphema relnoopener hrefhttpswwwtelegraphcoukbusiness20220929liztrussembarkedcoursesheermadnesstakingbankengland1 target_blankwarnsathat peronist policies careless ideological government set course sheer madness country jeopardy certain new era fashions economics things outside conservative party rest world hasa relnoopener hrefhttpswwwcsisorganalysisshockandincredulitywhymarketsdontbuynewbritishgovernmentsgrowthplan target_blankfirmly rejectedathe seventies dogmas brought britaina relnoopener hrefhttpsunherdcom202102theideologythatbrokebritain target_blankdecades stagnation underinvestmenta far rosier international climate currently inhabitp pit like story ofema relnoopener hrefhttpsenwikipediaorgwikithe_monkey27s_paw target_blankthe monkeys pawaem long demanding conservative leader committed bold decisive action party chose suicide bomber questions surely harm cause country time remaining bring conservative party truss forgot british public vote dreading economic winter harder previously experienced voting public looks decisively rejected trussonomics deliver labour greatest parliamentary majoritya relnoopener hrefhttpstwittercomvalen10francoisstatus1575548551660118016s20takpmctxfu79kjugs1nbh1q target_blankin british political historya story past years brexit 2019 conservative landslide labours coming victory british public desirous radical change political class struggling comprehend means let deliver conservatives elected simple mandate reform britains failing economic model slash currenta relnoopener hrefhttpswwwtelegraphcouknews20220930massmigrationmuchbiggerproblemtorieseconomy target_blankrecordhigh levels immigrationa instead truss doubling bothp pit matter great cosmic irony week truss lost red wall platform encapsulating brexit vote keir starmer won backa relnoopener hrefhttpsunherdcomthepostkeirstarmerfinallygoesbluelabour target_blankwith postliberal messagea centred direct investment state capacity public services home ownership simplest supply reform housebuilding libertarian think tanksa hrefhttpstwittercommrharrycolestatus1573254916918988800s20toxlcqjemfzqx_bbaohkq9wwho gleefully rushed ownershipaof budget announced ownership results destroyed party hollowed stripped vestiges tory thinkingp pthough disaster conservative party minibudget apparentlya hrefhttpstwittercommontiestatus1574759025438326785s20toxlcqjemfzqx_bbaohkq9wa triumph ieaa freemarket think tank long advanced ideology having groomed truss kwarteng party warned time time cooked isa relnoopener hrefhttpstwittercomproftimbalestatus1575756143401394176s20takpmctxfu79kjugs1nbh1q target_blankas repellent ordinary votersaas traditionalist toriesp diva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnara hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages52101073scalede16627447474831300x169jpgadiva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspansuggested readingspanaa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarh5the mythic power king charles iiih5apa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanbyspan aris roussinosapdivadiv pthe ideologues crashed britain conservative party cliff party requires time office relearn toryism principles shorn libertarian accretions driven chaos edge extinction wreckers entirely driven british conservatism stolen clothes mischief far long tory case voting conservative party party puts shortterm survival national interest business running countryp pit tragic irony british conservatism 2022 reason vote tory cons like ieas julian jessop kristian niemitza relnoopener hrefhttpstwittercomk_niemietzstatus1573967083347517443s20toxlcqjemfzqx_bbaohkq9w target_blankwelcoming trusss push massively increased immigrationa means restraining selfdestructive zealotry economic liberals lie labour party warmest responses starmers conference speech warned decline inevitable promised labour party party reindustrialisation national selfreliance home ownership support ordinary people came froma relnoopener hrefhttpstwittercommontiestatus1574759025438326785s20toxlcqjemfzqx_bbaohkq9w target_blanktory commentatorsaa relnoopener hrefhttpstwittercomtimothy_stanleystatus1574768061974020096s20toxlcqjemfzqx_bbaohkq9w target_blankaghast trusss radical liberal visionap pit tories representing partys paternalist social conscience struck contrast trusss wrecking ball starmers softly postliberal vision gavin rice conservativecentre social justicethink tanka relnoopener hrefhttpstwittercomgavinantonyricestatus1574759942644539396s20toxlcqjemfzqx_bbaohkq9w target_blankobservesa starmer laid postliberal brexit controlled immigration pride community democratic control buying making selling britain potential active government tories shouldnt allowing control turf path chose voters punish party blamep pit remarkable observe trusss mentors iea found time torelease paper hrefhttpsunherdcomwpcontentuploads202209takinglibertiespdfemtaking liberties postliberals wrong personal freedomem jamie whyteadenouncing rival postliberal trend conservative thought political philosophy faintest echoes rewarded labour prospect historic landslide paper gain traction true poorly argued mishmash philosophical sophistry amalgamated strawman version distinct political tendencies thought necessary release indicative intellectual energy lies conservatism sides atlanticp diva hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnara hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarimg srchttpsunherdcomwpcontentuploads202207gettyimages12419603421scalede1658248409661300x173jpgadiva hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarh5kemi badenoch saved toriesh5apa hrefhttpsunherdcom202207kemibadenochhassavedthetoriesrefinnarspanbyspan aris roussinosapdivadiv pyet paper presents fascinating insight worldview crankish doctrine british public visibly overwhelmingly rejects author rejects notion common good essential building block modern postliberalism traditional toryism associating idea compulsion hands state author writes postliberals believe politicians view good life specifically postliberals traditionalist view use powers state sure people live describes proposed wayof life authoritarianism regime politicians use state power live good lifep pto reach conclusion author conflates different american british postliberal strands thought currently war heated exchange open letters theemamerican conservativeem adopts framing harderedged american postliberalisms vision catholicadministrative state condemn british postliberalism truth conservative variant socialism infused traditionalist tory discomfort modernity drawn nations distinct historical path british postliberals like social democrats believe nations good prosperity enhanced given support state settle form families homes wasa hrefhttpsunherdcom202207britainneedsmacmillannotthatchera basic tenet toryism tooa different thing state compulsion roaming squads tweedjacketed postliberals forcing happy singletons marry frogmarching suburban semisp pbut basic expression common good vision hell radical iea liberal warns policies cause people marry way tax incentives harm good sound marriage involves forgoing sources happiness john gain happiness travelling world seducing strangers nightclubs reordering british economy lives prosperity british people hypothetical johns mission global seduction simply conservatism form party prioritise philosophy national good fully deserves disaster coming wayp pbut paper asserts postliberal claim liberalism leads social atomisation construction obstacles formation family life false argues state support wish belief helping wish secure settled domesticity attain impinge johns absolute freedom clear postliberal government prevent john liberals wished lives instead simply support wished basic goods home ownership domestic comfort security attain apparently anathema iea sadly assume notionally conservative governmentp diva hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnara hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarimg srchttpsunherdcomwpcontentuploads202202gettyimages1064754862300x205jpgadiva hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarspansuggested readingspanaa hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarh5boris johnsons squandered chanceh5apa hrefhttpsunherdcom202205thetragedyofborisjohnsonrefinnarspanbyspan aris roussinosapdivadiv pcoercion global market forces simply liberation exact vision entirety social life family nation subject torn apart destructive power unrestrained market postliberals british voters reject precisely outcome liberals purest form like truss think tanks formed worldview try summon painful rites destruction selfsacrifice earthly salvation attained society holds good hurled flames politics economics frustrated religious impulse drives liberalismp plike communists wave away misery destruction attempt apply vision practice far entailed free market fundamentalists likea relnoopener hrefhttpswwwnewstatesmancompoliticsconservatives202209liztrussrisemarketmillennialsfreemarketideology target_blanktruss think tanks heraassert problem failed vision properly applied instead guided tory pragmatism postliberalism rejects fantastical visions future favour future partly shaped forms social economic life existed capitalism world far perfect failings known capable effectively amelioratedp pbut stands home postliberal tories wary free market force destructive tradition social order conservative party exists instead grateful given free rein libertarians discredited doctrine electoral poison short tumultuous days like state funeral trusss accession great symbolic moment marked nadir tietjens toryism philosophical tradition conservative party total victory radical form economic liberalism like alchemist turning gold lead transmuted 2019s electoral landslide disaster tory case truss purely accelerationist catastrophe brought tow finally exorcise thatchers unquiet ghost allow party form conservative politics succeeds party power warnings reflect toryism actually meansp pbut starmers labour learned lessons brexit 2019 rejected radical economic liberalism pledged deliver common good certainly space lose conservatives failed restrain economic liberal extremists starmer restrain extremist social liberals labours ranks views ordinary voter deems equally strange repulsive basic bread butter policy contrast labour party pledging build homes conservative government lose britons homes absolutep pif achieve aim let promises deliver brexit works entire country return manufacturing capacity british shores state investment labour deserves win landslide victory conservativesa relnoopener hrefhttpswwwspectatorcoukarticlewhatdothetorieshavetoshowfromtheirtimeinpower target_blankchose squandera choosing truss conservative party chose tory case labourp hrefhttpsunherdcom202210liztrusshasbetrayedconservatismappcommentsview 23 commentsa

633cb48fc1fe0b956fc76fd7

Biden heads to New York, New Jersey to visit IBM, fundraise

ppresident biden on thursday will travel to new york and new jersey to promote his economic agenda and make two fundraising stops ahead of the midterm electionsp phe will first travel to poughkeepsie ny where he will visit tech company ibms campus he will deliver remarks on his economic agenda which will include creating jobs in the hudson valley lowering costs and promoting manufacturing in america according to the white housep plater on thursday he will fundraise for democrats just weeks ahead of the crucial midterm electionsp pthe president will travel to red bank nj where he will participate in a reception for the democratic national committee and he will participate in a reception for the democratic senatorial campaign committee in new york city p pthe trip will be bidens third jaunt out of washington this week marking an uptick in travel for the president this fall as the election approachesp pthe president on monday traveled to puerto rico to survey damage from hurricane fiona as well as meet with victims and local leaders the president will visit florida on wednesday to survey damage from hurricane ian and is set to meet with gop gov ron desantisp

ppresident biden thursday travel new york new jersey promote economic agenda fundraising stops ahead midterm electionsp phe travel poughkeepsie ny visit tech company ibms campus deliver remarks economic agenda include creating jobs hudson valley lowering costs promoting manufacturing america according white housep plater thursday fundraise democrats weeks ahead crucial midterm electionsp pthe president travel red bank nj participate reception democratic national committee participate reception democratic senatorial campaign committee new york city p pthe trip bidens jaunt washington week marking uptick travel president fall election approachesp pthe president monday traveled puerto rico survey damage hurricane fiona meet victims local leaders president visit florida wednesday survey damage hurricane ian set meet gop gov ron desantisp

633cb4b4c1fe0b956fc76fe0

The Many Faces of Marxism

ptheres a great and frustrating irony about marxism on the one hand it is extremely simplealmost cartoonishly so on the other hand millions of pages of extremely complicated writing exist trying to make it true simplifying marxism then is no simple task truly being one of the most influential pseudointellectual religious currents of the last century and a half a great deal could be said about marxism in an attempt to simplify it to its basic essence most people go about this incorrectly by assuming marxism is a complicated economic and social theory of political economyp pmarx certainly wrote quite a lot in that direction but something that can be said for certain is that the basic essence of his work is emnotem an economic or even a social theory in fact its not a emtheoryem at all instead its something much deeper that uses economic andor social theories as the relevant moving parts thats its own complicated story and one for another time to keep the matter relatively simple however lets start by saying that what constitutes the belief system identified with marxism is essentially a theory of man and a theory of the worldp pfor marx these theories are not actually separate as he wrote in his 1844 emcritique of hegels emphilosophy of right man is no abstract being squatting outside the world man is emthe world of manemstate society that is what makes man human is that he is the product of the world that he himself creates marxism is a circular theory of mans selfcreation the theory of the world at the center of the marxist belief system is therefore wholly dependent upon the ontological and teleological theory of man that is also at the center of marxist faithp pnevertheless these can be teased apart and at great generality and the result is a clarified understanding of marxism that makes a tremendous amount of sense out of the myriad bizarre features of todays world these include critical race theory queer andor gender theory and all the other theories of identity marxism and also whats happened to our educational systems and even political currents presently flowing at the supranational levelp h3marxs theory of man and the worldh3 pthe world of manstate societyas marx had it is the social structure that he creates for himself and that he indeed imprisons himself within man creates society and embodies that creation in the state and the society shaped by the state in turn creates man marx called the creation of society praxis and the creation of man by society the inversion of praxis praxis is theoryinformed activism so activism or the work done in light of marxist theory it is the transforming activity done by man on the world of man the inversion of praxis is social conditioning the society that man has created for himself socially conditions him almost completely deterministically man is limited and thus psychically incarcerated by the limitations of his social conditioning through the inversion of praxisp ppower in the world of man is not equal however thus neither is the capacity to create society and through it to create man there is a division of labor which like the fall in genesis has estranged man from other men and in fact from himself as he wrote in the emeconomic and philosophic manuscriptsem of 1844 communism is the answer to mans estrangement from himself and thus mans estrangement from manp pemcommunismem as the empositiveem transcendence of emprivate propertyem as emhuman selfestrangementem and therefore as the real emappropriationem of the emhumanem essence by and for man communism therefore as the complete return of man to himself as a emsocialem ie human beinga return accomplished consciously and embracing the entire wealth of previous development this communism as fully developed naturalism equals humanism and as fully developed humanism equals naturalism it is the emgenuineem resolution of the conflict between man and nature and between man and manthe true resolution of the strife between existence and essence between objectification and selfconfirmation between freedom and necessity between the individual and the species communism is the riddle of history solved and it knows itself to be this solution pp 9697p pbecause man is estranged from himself and from others by the existence of private property power is unequal he is forced to live in an alienated state in an alien world in which the power dynamics that maintain private property prevent him not only from his birthright in the garden where no one works but also from knowing himself as a perfectly social being which is as someone entitled to be there in eden on his own terms thus strange as it sounds by maintaining his belief in private property man condemns himself to toil and death so that the original sin of owning things as individuals can be maintainedp pthese power relations flow from property however because ownership confers power the owners are the ones who set the terms of society and thus they set the terms to justify the injustices that make their lives possible they through ownership stratify society and place themselves in the position of exploiting all but themselves while excusing themselves from any recognition that they engage in wholesale dehumanization for their own benefit in this regard property owners declare themselves the demiurgic creators of a corrupt and evil society they do this by writing a religious mythology justifying their own privilege what marx called ideology at the bottom of ideology is the belief in property ownership itself by which the demonic forces of privilege fool people into believing the division of societyof man from man and thus social man from himselfis fair just and even naturalp psociety then which conditions man through the inversion of praxis is emstratifiedem its separated into a class of people with access to that special form of property and those who are excluded from it but forced in some way to maintain itto the sole benefit of the people who have access to it the property holders grant themselves access to property effectively by fiat they then write their ideology to rationalize this hierarchy of society and their position within it as natural and just and people on both sides of the line of stratification are induced to accept it as just the way it is where religion is the opiate of the people wrote marx ideology is the medical theory that prescribes itp psociety as the world of man then is ordered in an illegitimate hierarchy by people who had not right to claim status over others in the first place according to marx certain people having laid privatizing claim to a special form of property that advantages them have structured society so that their privilege and the exploitation that enable it are accepted they get to write history and they write it so that their divisive sin is rationalized and theyll continue to be the winners society is stratified into those privileged by access to the special form of property and those who are oppressed by exclusion from it so that man forgets who he truly is creator and product of a social system called society and thus a perfectly social being in one of his great rejections of god and both presumably and ironically his parents marx wrotep pa embeingem only considers himself independent when he stands on his own feet and he only stands on his own feet when he owes his emexistenceem to himself a man who lives by the grace of another regards himself as a dependent being but i live completely by the grace of another if i owe him not only the maintenance of my life but if he has moreover emcreatedem my lifeif he is the emsourceem of my life when it is not of my own creation my life has necessarily a source of this kind outside of it the emcreationem is therefore an idea very difficult to dislodge from popular consciousness the fact that nature and man exist on their own account is emincomprehensibleem to it because it contradicts everything emtangibleem in practical life emepmem p 106p pthe direct reading of this passage is easily understood in the singular personal emiem marx writes it in even while he lived completely dependently on his family his wifes family and his collaborator friedrich engels when we realize it actually speaks not of the individual marx but of man as a collectivemankind itselfusing marx as an example and remember that through creating his own society collective man creates collective man and individual men it takes on another meaning man isnt emindependentem he is eminterdependentem man owes his existence to society neither dependent as its object or independent as its sole subject but interdependent subjectivity and objectivity in dialectical relationship selfappointed property holders have no right to create or maintain the lives of others forcing them into dependence and life by their grace man is therefore socialist in his nature as this is the only possible solution to this riddle of history in which the source of mans life becomes man not in the singular but in the collective men in the individual owe their lives to man in the collective which is only possible when men understand who they always were and thus who they are intended toem becomeem through the magical cycle of praxis and its neverending inversionp h3marxs purpose for beingh3 pthroughout his writings karl marx was obsessed with explaining why man is no mere animal there may be no god but man is emnotem an animal or a machine he is something higher he is in fact the one species on the planet that emcreates himselfem what makes man into man rather than mere animal is his capacity for bringing into existence that which he can envision in his imagination his emsubjectivityem is what makes him human and his capacity to be a emconscious subjectem aware of his own subjectivity and capacity to create from within it is what defines his humanityp pin the emeconomic and philosophic manuscriptsem marx gives a long and fairly tortured account of the genealogy of man that utterly fails to account for the infinite regress he invokesp pnow it is certainly easy to say to the single individual what aristotle has already said you have been begotten by your father and your mother therefore in you the mating of two human beingsa speciesact of human beingshas produced the human being you see therefore that even physically man owes his existence to man therefore you must not only keep sight of the emoneem aspectthe eminfiniteem progression which leads you further to inquire who begot my father who his grandfather etc you must also hold on to the emcircular movementem sensuously perceptible in that progress by which man repeats himself in procreation emmanem thus always remaining the subject you will reply however i grant you this circular movement now grant me the progress which drives me ever further until i ask who begot the first man and nature as a whole i can only answer you your question is itself a product of abstraction ask yourself how you arrived at that question ask yourself whether your question is not posed from a standpoint to which i cannot reply because it is wrongly put ask yourself whether that progress as such exists for a reasonable mind when you ask about the creation of nature and man you are abstracting in so doing from man and nature you postulate them as emnonexistentem and yet you want me to prove them to you as emexistingem now i say to you give up your abstraction and you will also give up your question or if you want to hold on to your abstraction then be consistent and if you think of man and nature as emnonexistentem then think of yourself as nonexistent for you too are surely nature and man dont think dont ask me for as soon as you think and ask your emabstractionem from the existence of nature and man has no meaning or are you such an egotist that you conceive everything as nothing and yet want yourself to exist emepmem pp 106107p pneedless to say marx was weird and weirdly imperious when confronted with an obvious flaw in his selfbegetting conception of man the false resolution marx seems to have had in mind however is that man became human by lifting himself out of animality bit by slow bit through the endless dialectical cycle of praxis and the inversion of praxis thus man made himself though mostly unconscious of the fact that he was making himself and of the dialectical means by which he was making himself how though did man make himself and thus sublate himself above the other animals sociality man made himselfem sociallyem through his society which he created for himself in the first place thus man is a social being and if he hadnt fallen through the invention of private property and thus his own selfestrangement he would still realize he is a social being marxs antiquated word for this is species being a man who lives for the benefit of his species emand who knows itemp pfor labour emlife activityem emproductive lifeem itself appears to man in the first place merely as a emmeansem of satisfying a needthe need to maintain physical existence yet the productive life is the life of the species it is lifeengendering life the whole character of a speciesits speciescharacter is contained in the character of its life activity and free conscious activity is mans speciescharacter life itself appears only as a emmeans to lifeemp pthe animal is immediately one with its life activity it does not distinguish itself from it it is emits life activityem man makes his life activity itself the object of his will and of his consciousness he has conscious life activity it is not a determination with which he directly merges conscious life activity distinguishes man immediately from animal life activity it is just because of this that he is a speciesbeing or it is only because he is a speciesbeing that he is a conscious being ie that his own life is an object for him only because of that is his activity free activity estranged labour reverses this relationship so that it is just because man is a conscious being that he makes his life activity his emessential beingem a mere means to his emexistenceem emepmem p 73p pfor animals they emareem their life activity that is they are what constitutes their survival this isnt actually different for man but the life activity of man has a different character because of mans consciousness mans life activity is the construction of society by which he constructs himself through himself it is something he can sit apart from and contemplate and act upon willfully envisioning how he wants it to be created man therefore owes his consciousness to his society to others and his interdependent relationships with others in fact his life activity is primarily this the conscious creation of himself and his societythus the future of himselfp pin creating a emworld of objectsem by his practical activity in his emwork uponem inorganic nature man proves himself a conscious speciesbeing ie as a being that treats the species as its own essential being or that treats itself as a speciesbeing admittedly animals also produce they build themselves nests dwellings like the bees beavers ants etc but an animal only produces what it immediately needs for itself or its young it produces onesidedly whilst man produces universally it produces only under the dominion of immediate physical need whilst man produces even when he is free from physical need and only truly produces in freedom therefrom an animal produces only itself whilst man reproduces the whole of nature an animals product belongs immediately to its physical body whilst man freely confronts his product an animal forms objects only in accordance with the standard and the need of the species to which it belongs whilst man knows how to produce in accordance with the standard of every species and knows how to apply everywhere the inherent standard to the object man therefore also forms objects in accordance with the laws of beauty emepmem pp 7374p pthe problem is that the division of labor has alienated man from this true nature of himself which he could know if he didnt believe labor as it occurs under the division of labor is what hes supposed to be doing with himselfp pthe emdivision of labourem is the economic expression of the emsocial character of labourem within the estrangement or since emlabourem is only an expression of human activity within alienation of the manifestation of life as the alienation of life the emdivision of labourem too is therefore nothing else but the emestrangedem emalienatedem positing of human activity as a emreal activity of the speciesem or as emactivity of man as a speciesbeingem emepmem p 122p pwhats the resolution communism as we read from him before communism therefore as the complete return of man to himself as a emsocialem ie human beinga return accomplished consciously and embracing the entire wealth of previous development how is it to be achieved according to the emcommunist manifestoem communism can be summarized in a single sentence abolition of private property ch 2 in other words man is to abolish private property and thereby undo his fall and reinstate his true nature as a speciesbeing which is essentially and not at all crudely communist he is a being that has arrived at or more accurately returned to the empositive transcendence of private propertyemp pof course that doesnt really answer emhowem the abolition of private property and the division of labor that sustains it is to be accomplished especially given that man confuses labor under division as the labor hes meant and made to be doing before explaining the how briefly note emwhyem man is so wrong about what he believes hes supposed to be doing the inversion of praxis being raised in a divided labor condition his subjective range is limited to his own estrangement which socialized him to believe thats what he should be doing escaping this issue requires him to be conscious of himself as someone emwho could do something elseem thats where the emhowem in marxism appears returning to the point as marx had it leaving out the parts distinguishing man from animal and continuing to the essential point further down the pagep pin creating a emworld of objectsem by his practical activity in his emwork uponem inorganic nature man proves himself a conscious speciesbeing ie as a being that treats the species as its own essential being or that treats itself as a speciesbeing it is just in his work upon the objective world therefore that man really proves himself to be a emspeciesbeingem this production is his active specieslife through this production nature appears as emhisem work and his reality the object of labour is therefore the emobjectification of mans specieslifeem for he duplicates himself not only as in consciousness intellectually but also actively in reality and therefore he sees himself in a world that he has created emepmem pp 7374p pthe fall of man through the division of labor really is characterized as a fall of man man becomes estranged from himself in the same way he became estranged from god in the fall from edenbut now he is to be seen as his own creator through the demiurgic powers that manifest in society itself the result of his fall is that man comes to believe himself to be an emindividualem and thus he doesnt and cant know who he isp pin estranging from man 1 nature and 2 himself his own active functions his life activity estranged labour estranges the emspeciesem from man it changes for him the emlife of the speciesem into a means of individual life first it estranges the life of the species and individual life and secondly it makes individual life in its abstract form the purpose of the life of the species likewise in its abstract and estranged form emepmem p 73p pin tearing away from man the object of his production therefore estranged labour tears from him his emspecieslifeem his real objectivity as a member of the species and transforms his advantage over animals into the disadvantage that his inorganic body nature is taken away from him estranged labour turns thus em[m]ans speciesbeingem both nature and his spiritual speciesproperty into a being emalienem to him into a emmeansem for his emindividual existenceem it estranges from man his own body as well as external nature and his spiritual aspect his emhumanem aspect emepmem p 74p pfor marx mans human aspect the quality in him that makes him essentially human instead of animal is that he is a communist thus marx named his view humanism and claimed conscious marxist praxis humanizes man society and the worldp pthe abolition of private property is therefore the complete emancipation of all human senses and qualities but it is this ememancipationem precisely because these senses and attributes have become subjectively and objectively emhumanem the eye has become a emhumanem eye just as its emobjectem has become a social emhumanem objectan object made by man for man the emsensesem have therefore become directly in their practice emtheoreticiansem they relate themselves to the emthingem for the sake of the thing but the thing itself is an emobjective humanem relation to itself and to man and vice versa need or enjoyment have consequently lost its emegotisticalem nature and nature has lost its mere emutilityem by use becoming emhumanem use emepmem p 101p pthe goal of this project is making each and allman society and world including naturefit for man as he truly is if only he could transcend his depraved propertyowning false nature which he wove into himself through generations of the inversion of praxis within the fallen propertyowning society he sinfully created for himselfp p[t]he emsocialem character is the general character of the whole movement emjust asem society itself produces emman as manem so is society emproducedem by him activity and enjoyment both in their content and in their emmode of existenceem are emsocialem emsocialem activity and emsocialem enjoyment the emhumanem aspect of nature exists only for emsocialem man for only then does nature exist for him as a bond with manas his existence for the other and the others existence for himand as the lifeelement of human reality only then does nature exist as the emfoundationem of his own emhumanem existence only here has what is to him his emnaturalem existence become his emhumanem existence and nature become man for him thus emsocietyem is the complete unity of man with naturethe true resurrection of naturethe consistent naturalism of man and the consistent humanism of nature emepmem p 98p pas a religion the point of marxism is to teach man to remember who he is notice i didnt say to teach people or to teach men who they are all of man as a collective species has to remember emwho he isem he is a speciesbeing his true nature is a fully social animal that hasnt fallen by seizing private property declaring this is mine thus he declares i am because i am someone who can possess this is a man who has emforgottenem that he is social because hes been socialized to believe he is not because man is always creating society praxis conscious or not and society is always creating man inversion of praxis man is emalwaysem a social being the question for marx is merely whether or not he is conscious of itp pthe individual emis the social beingem his manifestations of lifeeven if they may not appear in the direct form of communal manifestations of life carried out in association with othersemareem therefore an expression and confirmation of emsocial lifeem mans individual and specieslife are not emdifferentem however muchand this is inevitablethe mode of existence of the individual is a more emparticularem or more emgeneralem mode of the life of the species or the life of the species is a more emparticularem or more emgeneralem individual life emepmem p 99p pthe individual for marx is someone who can assert i am someone who can have this thing that i withhold from you while pretending thats not a social relation and the communist is someone with the emhumanem consciousness that returns him to his social naturep pas a corollary we see marxs theory of alienation by labor because you might value that thing and want it or something similar or the advantage it confers my assertion of having something enables me to require you to work for me to gain access to it thus i estrange you from who you are someone who can subjectively imagine and then create objects and see yourself as their creator because youre creating objects emfor meem out of emmyem vision we become estranged and the power that follows from possession thus individuality estranges us it is sin and the wages of sin are toil and deathp pfirst the fact that labour is emexternalem to the worker ie it does not belong to his intrinsic nature that in his work therefore he does not affirm himself but denies himself does not feel content but unhappy does not develop freely his physical and mental energy but mortifies his body and ruins his mind the worker therefore only feels himself outside his work and in his work feels outside himself he feels at home when he is not working and when he is working he does not feel at home his labour is therefore not voluntary but coerced it is emforced labourem it is therefore not the satisfaction of a need it is merely a emmeansem to satisfy needs external to it its alien character emerges clearly in the fact that as soon as no physical or other compulsion exists labour is shunned like the plague external labour labour in which man alienates himself is a labour of selfsacrifice of mortification lastly the external character of labour for the worker appears in the fact that it is not his own but someone elses that it does not belong to him that in it he belongs not to himself but to another just as in religion the spontaneous activity of the human imagination of the human brain and the human heart operates on the individual independently of himthat is operates as an alien divine or diabolical activityso is the workers activity not his spontaneous activity it belongs to another it is the loss of his self emepmem p 71p pthis in turn inverts man and animal reducing man to a mere animal that only feels human when engaging in animal activities like eating drinking and having sex that which is divine within manhis essential human nature and what every other esoteric religious sect before marx recognized as his immortal spiritis not merely lost but debased so that in its depravity it repeats for itself the fall by seeking itself in the mundane corporeal fallen world of bodily need and gratification man for marx is thuslyem debasedemem depravedem andem dehumanized emby the existence of private property and the social relations it producesp pas a result therefore man the worker only feels himself freely active in his animal functionseating drinking procreating or at most in his dwelling and in dressingup etc and in his human functions he no longer feels himself to be anything but an animal w hat is animal becomes human and what is human becomes animal emepmem p 71p pmarx offers a solution to this problem as we have already seen communism he believes it follows from consciousness orem gnosisem of this true nature of man and his conditions under marxism as a religion man is not merely men are to be made conscious of their true nature and the structural conditions engendered by that which has caused their fall which is private property in turn they have a duty of conscience to do the work in praxis to transform the world so that the next dialectical turn of the inversion of praxis will expand peoples consciousness further writes marx attempting to justify the utility of his own theorizing amid so many appeals to hard labor emmy ownem existence emisem social activity and therefore that which i make of myself i make of myself for society and with the consciousness of myself as a social being emepmem p 99p pthis process is to continue and continue and continue until man remembers who he is a speciesbeing who lives collectively and thus transcends private property as his own creator who knows himself to have created himself thusly he reenters eden emon his own termsem theres no need for a savior because man as a singular collective saves himself not faith but emarbeitemem macht freiemp pthe essential reason for this is the dialectical faith at the center of marxism man makes society thats praxis society in turn makes man thats the inversion of praxis man thus far has fallen and thereby made himself emunconsciousem of the dialectical conditions that shape his reality and thus himself but he can conscientize he can become aware of the conditions that shape his reality and himself and thus he can make himself as he should be recollecting in the hermetic sense his true nature as a speciesbeing which marx later called socialist man the creation of man through societythrough his state as mans selfmade messianic saviorcan be consciously directed back to where it should have been all along the prison of being can be escaped man can return home and know himself to have come home communism is the riddle of history solved and it knows itself to be this solutionp pthe only question then is what aspect or aspects of society make man through the inversion of praxis for marx who was a material determinist economic conditions make man so in order to consciously seize the means of producing society and man one must seize the means of material production the economic theory of marxism misses what marxism is entirely it merely identifies one potential software routine in the underlying dialectical operating system faith of dialectical transformation of man through the seizure of his means of selfproduction and there are others thus classical economic marxism gave way to cultural marxism gave way to critical marxism gave way to identity marxism gave way to woke marxism is giving way to sustainability marxism today same religion different plugin for determining what drives the inversion of praxisp h3marxism in full generalityh3 pmarxism in full generality then posits the existence of a special kind of bourgeois property generally capital to which some people grant themselves access while excluding everyone else this property empowers them to shape society for their own benefit while casting everyone else into enstrangement and alienationa prison at the level of their very beingp pto fully understand marxism the special property or capital under consideration must be conceived of very broadly there is material capital cultural capital social capital intellectual capital human capital and so on and access to any or all of these has to be considered the currently dominant versions of marxism view these various forms of capital or special bourgeois property to be intertwined with one another and impossible to understand in isolation their power is intersectionalp pthe special access to a form of bourgeois property stratifies society into a class that has it and a class that does not have it access to the property confers advantages to the people who have it leading them to want to keep it and rationalize keeping it through what marx named ideology it also confers power which they use to structure society to their own advantage the power they create is therefore systemic or structural in nature and it results from the interplay between the privileged class and those they exploit to maintain their privilegep pthe classes produced by this structural fall of man are therefore intrinsically in conflict with one another over access to the special property and the means of possessing it thus the overclass erects a system that estranges the everyday individual for marx the worker in the underclass from the product of his efforts and thus his ability to fully and truly be those with the power to direct this system of power currently referred to as privileged generate elaborate mythologies called ideologies that justify their access to the special property and the power it confers while exploiting others to increase the amount of it they have marx claimed that ideology mystifies reality and that marxism demystifies itp pideology functions in such a way as to ensure neither group is conscious of the true nature of society which is structural the goal however as marx and engels note in emthe communist manifestoem can be summarized in the single idea of abolition of private property of this special kind marxism bills itself as the sole path to the end of ideologynot this ideology or that ideology butem ideologyem itselfem in totoem it is therefore the only system of thought of its kind that somehow manages not to constitute an ideology but this is just another way marxists consider themselves better than everyone else and thereby trick themselvesp pit will be instructive to see this abstract expression of marxism in several more concrete forms we therefore now turn to a number of descriptive examplesp h3many faces of marxist faithh3 pthe basic structure of marxism repeats itself through every evolution of marxist theory and is always adhered to religiously and with the zealots fervor in every case a special form of property is at the center of the theory and the liberation of man depends on its abolition by which is meant its positive transcendencep pfor marx the special property was emcapitalem its ideology is emcapitalismem a caricature of market economies its winners are the embourgeoisieem and its losers the emworking classem who become a emproletariatem when awakened to emclass consciousnessem the structure of this society is enforced by structural emclassismem which is emmaterially deterministicem the goal of marxs economicmaterial marxism is theem abolition or transcendence of private propertyemp pin cultural marxism the special property is emcultural capitalem the power to define and set culture its ideology isem cultural capitalismem a form of cultural dominance its winners are the emculturally eliteem who are mostly the embourgeoisieem and its losers are emthose of low cultureem who were readily identified with the emworking classem they can be awakened into a emcultural proletariatem by awakening their emclass consciousnessem which includes an understanding of how cultural mores define the haves and havenots in society the structure of this society is enforced byem cultural hegemonyem which includes both emclassismem and emcultural classismem which are emmateriallyem and emstructurally deterministicem the goal of cultural marxism is to abolish the existing means of production of cultural values and to establish a counterhegemony that favors marxism within cultureproducing institutions eg family religion education media and law in order to emabolish or transcend bourgeois culture and class societyemp pin critical marxism the special property is emacceptabilityem its ideology isem positivismem by which is meant strict rationality and legalistic thinking at least in professional circles its winners are the emculturally eliteem and the emnormalem onedimensional man and its losers are the emculturally excludedem they can be awakened into emcritical theoristsem by adopting emcritical consciousnessem which is the understanding that a better society cannot be articulated in the terms of the existing society but that the features of the existing society they find dehumanizing can be critiqued the structure of this society is emmaterialem emculturalem and emsocial classismem and is maintained by emcommodificationem which is emmateriallyem and emstructurally deterministicem its goal is the emabolition of the existing terms of society a great refusalemp pin postmodern marxism not an onymoron the special property is emdiscursive dominanceem which is the ability to control how ideas and their networks of meanings are understood its ideology isem a belief in the stability and universality of meaningem its winners are the emsocioculturally eliteem and its losers are the emsocioculturally excludedem and emmarginalizedem they can be awakened into empostmodernismem or empostmodernradical skepticismem which is a general belief that all meaningmaking is an expression of power so essentially a consciousness of how power operates within and through society within its meaningmaking apparatuses the structure of this society is emdiscursive structuralismem which is emstructurally deterministicem its goal is the emabolition of privileging of meaningmakingemp pin critical race theory as i argue in a relnoopener hrefhttpsamznto3rkbhcx target_blankemrace marxismema the special property is emwhitenessem its ideology is emwhite supremacyem its winners are emwhitesem and emwhiteadjacentsem its losers are empeople of colorem either of these can become emantiracistsem when awakened to emrace consciousnessem instead of colorblindness the structure of this society is enforced by emsystemic racismem which is both emmateriallyem and emstructurally deterministicem its goal is theem abolition or transcendence of whitenessemp pin marxian feminism the special property is emmalenessem its ideology is empatriarchyem that men should lead society its winners are emmenem its losers are emwomenem and to a certain extent at least sometimes emhomosexual menem these can become emfeministsem when awakened with emfeminist consciousnessem the structure of this society is enforced by emmisogynyem emstructural sexismem emphallagocentrismemem gender normativityem andem sex essentialismem which can be both emmateriallyem and in multiple ways emstructurally deterministicem its goal is emthe abolition or transcendence of patriarchyemp pin queer theory the special property isem normalcyem its ideology isem cisheteronormativityem that it is regarded as normal to be straight and not trans its winners areem cisheterosexualsem andem people who pass as suchem its losers areem the abnormalem these can becomeem alliesem orem queerem when awakened withem queer consciousnessem the structure of this society is enforced byem homophobiaemem transphobiaem and otherem bigotries of normativityem which is both emmateriallyem and emstructurally deterministicem its goal isem the abolition or transcendence of normalcy and with it normativityem ie all norms and socially enforced categorical expectationsp pin disability studies the special property is emablebodiednessem its ideology is emableismem that it is in general better and more normal to be ablebodied instead of disabled in some way its winners are emthe ablebodiedem its losers are emthe disabledem who are disabled by the failure of society to accommodate disability as fully as it accommodates ability which is realized when disability is in no way any disadvantage at all these can become emdisability activistsem when awakened with a emcritical consciousness of ability statusem the structure of this society is enforced by emdisableismem which is both emmateriallyem and emstructurally deterministicem its goal is emthe abolition or transcendence of ableismemp pin fat studies the special property is emthinnessem its ideology is emthinnormativityem that it is normal for the human body not to be overweight in fact the term overweight is problematic because it implies thinnormativity by suggesting an ideal weight exists its winners are emthe thinem its losers are emthe fatem and embodies of sizeem these can become emfat activistsem when awakened with a emcritical fat consciousnessem the structure of this society is enforced by emfatphobiaem along with emhealthismem that it is important and valuable to be healthy which are both emmateriallyem and emstructurally deterministicem its goal is emthe abolition or transcendence of thinnormativityem and expectations about weight and body sizep pin freirean education the special property is emformal educationem or emliteracyem its ideology is one of educated society which values being emeducatedem and emliterateem in ways acceptable to the existing system its winners are the emformally educatedem and emliterateem regarded asem knowersem and its losers the emilliterateem who are actually knowers in their own right though the system excludes them their ways of knowing and their knowledges they are awakened through empolitical literacyem and emconscientizationem is the process of their awakening theem critically consciousem orem conscientizedem are those who have been awakened the structure of this society is enforced by expectations on emliteracyem and emformal educationem which are emmateriallyem and emstructurally deterministicem relegating the underclass to a culture of silence as freire has it the goal isem the abolition or transcendence of formal education and objective knowledgeem and thus the immediate goal is the reappropriation of education into a process of conscientiation and humanizationp pin climate justice the special property is emnot being impacted by humancaused climate changeem its ideology is emenergy abundance through nongreen energy sourcesem which are enabled by emneoliberalismem and emimperialismem its winners are emthe first worldem emthe fossilfuel industryem and emall privileged classesem who are believed to suffer fewer impacts of climate change its losers are emthe developing and undeveloped worldem and emeverybodyem especially emmembers ofem emoppressed classesem who benefit least from existing energy sources and suffer the consequences of climate change the most allegedly they are awakened through emgreen activismem and emblueem and they have a emclimate consciousnessem the structure of the existing society is largely enforced by empetrocapitalismem which runs a capitalist enterprise on the back of energy abundance produced by oil coal natural gas and nuclear power all of which are backed by emneoliberalismem with regard to energy policy which have emmaterialem and emstructurally deterministicem effects its goal is the abolition of black energy full reliance upon green energy the end of the oil coal and gas industries and environmental and climate justice redistribution globally according to alleged climate change production and damages its primary objective in branding is sustainabilityp pwe could go on into postcolonial theory health equity and on and on but we will not in all cases the mechanism is for the conscious to seize the means of production in the relevant domain and use that control to force redistribution and new norms that work toward abolishing the relevant form of special property by abolishing the special access or even its fundamental meaning doing so will abolish the special property and thus undo its contribution to the fall of man thus ending the estrangement the existence of that form of special property and its attendant power dynamic producep pwhat we see here is that marxism once understood properly as a esoteric faith of societal division and transmutation in alchemy by divide and unify or dissolve and precipitate has reared its head in many different forms but has not lost its essential character one additional example that grows significantly out of all of these preceding but especially the critical marxist line bears describingp pin sustainable marxism which obviously has a double meaning the special form of property is emproduction capacityem in general its ideology is emshareholder capitalismem its winners are emthe one percentem its losers are emthe ninetynine percentem emespecially women gender minorities sexual minorities racial minorities residents of the third world and all other members of marginalized groupsem these can become activists on behalf of the emsustainable development goalsem of the emunited nationsem and its em2030 agendaem and by behaving in ways that are emesg compliantem stakeholderdetermined environmental social and governance standards comprise esg compliance its goal is to emabolish shareholder capitalismem and emreplace it with stakeholder capitalismem or sustainable and inclusive capitalism which is not actually capitalism at all but a marketcontaining command economy not unlike the one in china under the ccpp h3the last wordh3 pits time we understand marxism for what it really is a cultreligious ideology of transforming the world back into eden by undoing the fall of man into producing stratified power dynamics through allegedly selfgranted access to special property it arises from a singular error which is the inability to perceive the legitimacy of a legitimate hierarchy and thus proceeds by means of ignorant destructive envy no matter which form of special property is under consideration it is always the same and so are its fruits restoring liberty and goodness to our lives depends on understanding thisp pthe post a relnofollow hrefhttpsnewdiscoursescom202210manyfacesofmarxismthe many faces of marxisma appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap

ptheres great frustrating irony marxism hand extremely simplealmost cartoonishly hand millions pages extremely complicated writing exist trying true simplifying marxism simple task truly influential pseudointellectual religious currents century half great deal said marxism attempt simplify basic essence people incorrectly assuming marxism complicated economic social theory political economyp pmarx certainly wrote lot direction said certain basic essence work emnotem economic social theory fact emtheoryem instead deeper uses economic andor social theories relevant moving parts thats complicated story time matter relatively simple lets start saying constitutes belief system identified marxism essentially theory man theory worldp pfor marx theories actually separate wrote 1844 emcritique hegels emphilosophy right man abstract squatting outside world man emthe world manemstate society makes man human product world creates marxism circular theory mans selfcreation theory world center marxist belief system wholly dependent ontological teleological theory man center marxist faithp pnevertheless teased apart great generality result clarified understanding marxism makes tremendous sense myriad bizarre features todays world include critical race theory queer andor gender theory theories identity marxism whats happened educational systems political currents presently flowing supranational levelp h3marxs theory man worldh3 pthe world manstate societyas marx social structure creates imprisons man creates society embodies creation state society shaped state turn creates man marx called creation society praxis creation man society inversion praxis praxis theoryinformed activism activism work light marxist theory transforming activity man world man inversion praxis social conditioning society man created socially conditions completely deterministically man limited psychically incarcerated limitations social conditioning inversion praxisp ppower world man equal capacity create society create man division labor like fall genesis estranged man men fact wrote emeconomic philosophic manuscriptsem 1844 communism answer mans estrangement mans estrangement manp pemcommunismem empositiveem transcendence emprivate propertyem emhuman selfestrangementem real emappropriationem emhumanem essence man communism complete return man emsocialem ie human beinga return accomplished consciously embracing entire wealth previous development communism fully developed naturalism equals humanism fully developed humanism equals naturalism emgenuineem resolution conflict man nature man manthe true resolution strife existence essence objectification selfconfirmation freedom necessity individual species communism riddle history solved knows solution pp 9697p pbecause man estranged existence private property power unequal forced live alienated state alien world power dynamics maintain private property prevent birthright garden works knowing perfectly social entitled eden terms strange sounds maintaining belief private property man condemns toil death original sin owning things individuals maintainedp pthese power relations flow property ownership confers power owners ones set terms society set terms justify injustices lives possible ownership stratify society place position exploiting excusing recognition engage wholesale dehumanization benefit regard property owners declare demiurgic creators corrupt evil society writing religious mythology justifying privilege marx called ideology ideology belief property ownership demonic forces privilege fool people believing division societyof man man social man himselfis fair naturalp psociety conditions man inversion praxis emstratifiedem separated class people access special form property excluded forced way maintain itto sole benefit people access property holders grant access property effectively fiat write ideology rationalize hierarchy society position natural people sides line stratification induced accept way religion opiate people wrote marx ideology medical theory prescribes itp psociety world man ordered illegitimate hierarchy people right claim status place according marx certain people having laid privatizing claim special form property advantages structured society privilege exploitation enable accepted write history write divisive sin rationalized theyll continue winners society stratified privileged access special form property oppressed exclusion man forgets truly creator product social system called society perfectly social great rejections god presumably ironically parents marx wrotep pa embeingem considers independent stands feet stands feet owes emexistenceem man lives grace regards dependent live completely grace owe maintenance life emcreatedem lifeif emsourceem life creation life necessarily source kind outside emcreationem idea difficult dislodge popular consciousness fact nature man exist account emincomprehensibleem contradicts emtangibleem practical life emepmem p 106p pthe direct reading passage easily understood singular personal emiem marx writes lived completely dependently family wifes family collaborator friedrich engels realize actually speaks individual marx man collectivemankind itselfusing marx example remember creating society collective man creates collective man individual men takes meaning man isnt emindependentem eminterdependentem man owes existence society dependent object independent sole subject interdependent subjectivity objectivity dialectical relationship selfappointed property holders right create maintain lives forcing dependence life grace man socialist nature possible solution riddle history source mans life man singular collective men individual owe lives man collective possible men understand intended toem becomeem magical cycle praxis neverending inversionp h3marxs purpose beingh3 pthroughout writings karl marx obsessed explaining man mere animal god man emnotem animal machine higher fact species planet emcreates himselfem makes man man mere animal capacity bringing existence envision imagination emsubjectivityem makes human capacity emconscious subjectem aware subjectivity capacity create defines humanityp pin emeconomic philosophic manuscriptsem marx gives long fairly tortured account genealogy man utterly fails account infinite regress invokesp pnow certainly easy single individual aristotle said begotten father mother mating human beingsa speciesact human beingshas produced human physically man owes existence man sight emoneem aspectthe eminfiniteem progression leads inquire begot father grandfather etc hold emcircular movementem sensuously perceptible progress man repeats procreation emmanem remaining subject reply grant circular movement grant progress drives ask begot man nature answer question product abstraction ask arrived question ask question posed standpoint reply wrongly ask progress exists reasonable mind ask creation nature man abstracting man nature postulate emnonexistentem want prove emexistingem abstraction question want hold abstraction consistent think man nature emnonexistentem think nonexistent surely nature man dont think dont ask soon think ask emabstractionem existence nature man meaning egotist conceive want exist emepmem pp 106107p pneedless marx weird weirdly imperious confronted obvious flaw selfbegetting conception man false resolution marx mind man human lifting animality bit slow bit endless dialectical cycle praxis inversion praxis man unconscious fact making dialectical means making man sublate animals sociality man himselfem sociallyem society created place man social hadnt fallen invention private property selfestrangement realize social marxs antiquated word species man lives benefit species emand knows itemp pfor labour emlife activityem emproductive lifeem appears man place merely emmeansem satisfying needthe need maintain physical existence productive life life species lifeengendering life character speciesits speciescharacter contained character life activity free conscious activity mans speciescharacter life appears emmeans lifeemp pthe animal immediately life activity distinguish emits life activityem man makes life activity object consciousness conscious life activity determination directly merges conscious life activity distinguishes man immediately animal life activity speciesbeing speciesbeing conscious ie life object activity free activity estranged labour reverses relationship man conscious makes life activity emessential beingem mere means emexistenceem emepmem p 73p pfor animals emareem life activity constitutes survival isnt actually different man life activity man different character mans consciousness mans life activity construction society constructs sit apart contemplate act willfully envisioning wants created man owes consciousness society interdependent relationships fact life activity primarily conscious creation societythus future himselfp pin creating emworld objectsem practical activity emwork uponem inorganic nature man proves conscious speciesbeing ie treats species essential treats speciesbeing admittedly animals produce build nests dwellings like bees beavers ants etc animal produces immediately needs young produces onesidedly whilst man produces universally produces dominion immediate physical need whilst man produces free physical need truly produces freedom therefrom animal produces whilst man reproduces nature animals product belongs immediately physical body whilst man freely confronts product animal forms objects accordance standard need species belongs whilst man knows produce accordance standard species knows apply inherent standard object man forms objects accordance laws beauty emepmem pp 7374p pthe problem division labor alienated man true nature know didnt believe labor occurs division labor hes supposed himselfp pthe emdivision labourem economic expression emsocial character labourem estrangement emlabourem expression human activity alienation manifestation life alienation life emdivision labourem emestrangedem emalienatedem positing human activity emreal activity speciesem emactivity man speciesbeingem emepmem p 122p pwhats resolution communism read communism complete return man emsocialem ie human beinga return accomplished consciously embracing entire wealth previous development achieved according emcommunist manifestoem communism summarized single sentence abolition private property ch 2 words man abolish private property undo fall reinstate true nature speciesbeing essentially crudely communist arrived accurately returned empositive transcendence private propertyemp pof course doesnt answer emhowem abolition private property division labor sustains accomplished especially given man confuses labor division labor hes meant explaining briefly note emwhyem man wrong believes hes supposed inversion praxis raised divided labor condition subjective range limited estrangement socialized believe thats escaping issue requires conscious emwho elseem thats emhowem marxism appears returning point marx leaving parts distinguishing man animal continuing essential point pagep pin creating emworld objectsem practical activity emwork uponem inorganic nature man proves conscious speciesbeing ie treats species essential treats speciesbeing work objective world man proves emspeciesbeingem production active specieslife production nature appears emhisem work reality object labour emobjectification mans specieslifeem duplicates consciousness intellectually actively reality sees world created emepmem pp 7374p pthe fall man division labor characterized fall man man estranged way estranged god fall edenbut seen creator demiurgic powers manifest society result fall man comes believe emindividualem doesnt cant know isp pin estranging man 1 nature 2 active functions life activity estranged labour estranges emspeciesem man changes emlife speciesem means individual life estranges life species individual life secondly makes individual life abstract form purpose life species likewise abstract estranged form emepmem p 73p pin tearing away man object production estranged labour tears emspecieslifeem real objectivity member species transforms advantage animals disadvantage inorganic body nature taken away estranged labour turns em[m]ans speciesbeingem nature spiritual speciesproperty emalienem emmeansem emindividual existenceem estranges man body external nature spiritual aspect emhumanem aspect emepmem p 74p pfor marx mans human aspect quality makes essentially human instead animal communist marx named view humanism claimed conscious marxist praxis humanizes man society worldp pthe abolition private property complete emancipation human senses qualities ememancipationem precisely senses attributes subjectively objectively emhumanem eye emhumanem eye emobjectem social emhumanem objectan object man man emsensesem directly practice emtheoreticiansem relate emthingem sake thing thing emobjective humanem relation man vice versa need enjoyment consequently lost emegotisticalem nature nature lost mere emutilityem use emhumanem use emepmem p 101p pthe goal project making allman society world including naturefit man truly transcend depraved propertyowning false nature wove generations inversion praxis fallen propertyowning society sinfully created himselfp p[t]he emsocialem character general character movement emjust asem society produces emman manem society emproducedem activity enjoyment content emmode existenceem emsocialem emsocialem activity emsocialem enjoyment emhumanem aspect nature exists emsocialem man nature exist bond manas existence existence himand lifeelement human reality nature exist emfoundationem emhumanem existence emnaturalem existence emhumanem existence nature man emsocietyem complete unity man naturethe true resurrection naturethe consistent naturalism man consistent humanism nature emepmem p 98p pas religion point marxism teach man remember notice didnt teach people teach men man collective species remember emwho isem speciesbeing true nature fully social animal hasnt fallen seizing private property declaring declares possess man emforgottenem social hes socialized believe man creating society praxis conscious society creating man inversion praxis man emalwaysem social question marx merely conscious itp pthe individual emis social beingem manifestations lifeeven appear direct form communal manifestations life carried association othersemareem expression confirmation emsocial lifeem mans individual specieslife emdifferentem muchand inevitablethe mode existence individual emparticularem emgeneralem mode life species life species emparticularem emgeneralem individual life emepmem p 99p pthe individual marx assert thing withhold pretending thats social relation communist emhumanem consciousness returns social naturep pas corollary marxs theory alienation labor value thing want similar advantage confers assertion having enables require work gain access estrange subjectively imagine create objects creator youre creating objects emfor meem emmyem vision estranged power follows possession individuality estranges sin wages sin toil deathp pfirst fact labour emexternalem worker ie belong intrinsic nature work affirm denies feel content unhappy develop freely physical mental energy mortifies body ruins mind worker feels outside work work feels outside feels home working working feel home labour voluntary coerced emforced labourem satisfaction need merely emmeansem satisfy needs external alien character emerges clearly fact soon physical compulsion exists labour shunned like plague external labour labour man alienates labour selfsacrifice mortification lastly external character labour worker appears fact elses belong belongs religion spontaneous activity human imagination human brain human heart operates individual independently himthat operates alien divine diabolical activityso workers activity spontaneous activity belongs loss self emepmem p 71p pthis turn inverts man animal reducing man mere animal feels human engaging animal activities like eating drinking having sex divine manhis essential human nature esoteric religious sect marx recognized immortal spiritis merely lost debased depravity repeats fall seeking mundane corporeal fallen world bodily need gratification man marx thuslyem debasedemem depravedem andem dehumanized emby existence private property social relations producesp pas result man worker feels freely active animal functionseating drinking procreating dwelling dressingup etc human functions longer feels animal w hat animal human human animal emepmem p 71p pmarx offers solution problem seen communism believes follows consciousness orem gnosisem true nature man conditions marxism religion man merely men conscious true nature structural conditions engendered caused fall private property turn duty conscience work praxis transform world dialectical turn inversion praxis expand peoples consciousness writes marx attempting justify utility theorizing amid appeals hard labor emmy ownem existence emisem social activity society consciousness social emepmem p 99p pthis process continue continue continue man remembers speciesbeing lives collectively transcends private property creator knows created thusly reenters eden emon termsem theres need savior man singular collective saves faith emarbeitemem macht freiemp pthe essential reason dialectical faith center marxism man makes society thats praxis society turn makes man thats inversion praxis man far fallen emunconsciousem dialectical conditions shape reality conscientize aware conditions shape reality recollecting hermetic sense true nature speciesbeing marx later called socialist man creation man societythrough state mans selfmade messianic saviorcan consciously directed prison escaped man return home know come home communism riddle history solved knows solutionp pthe question aspect aspects society man inversion praxis marx material determinist economic conditions man order consciously seize means producing society man seize means material production economic theory marxism misses marxism entirely merely identifies potential software routine underlying dialectical operating system faith dialectical transformation man seizure means selfproduction classical economic marxism gave way cultural marxism gave way critical marxism gave way identity marxism gave way woke marxism giving way sustainability marxism today religion different plugin determining drives inversion praxisp h3marxism generalityh3 pmarxism generality posits existence special kind bourgeois property generally capital people grant access excluding property empowers shape society benefit casting enstrangement alienationa prison level beingp pto fully understand marxism special property capital consideration conceived broadly material capital cultural capital social capital intellectual capital human capital access considered currently dominant versions marxism view forms capital special bourgeois property intertwined impossible understand isolation power intersectionalp pthe special access form bourgeois property stratifies society class class access property confers advantages people leading want rationalize keeping marx named ideology confers power use structure society advantage power create systemic structural nature results interplay privileged class exploit maintain privilegep pthe classes produced structural fall man intrinsically conflict access special property means possessing overclass erects system estranges everyday individual marx worker underclass product efforts ability fully truly power direct system power currently referred privileged generate elaborate mythologies called ideologies justify access special property power confers exploiting increase marx claimed ideology mystifies reality marxism demystifies itp pideology functions way ensure group conscious true nature society structural goal marx engels note emthe communist manifestoem summarized single idea abolition private property special kind marxism bills sole path end ideologynot ideology ideology butem ideologyem itselfem totoem system thought kind manages constitute ideology way marxists consider better trick themselvesp pit instructive abstract expression marxism concrete forms turn number descriptive examplesp h3many faces marxist faithh3 pthe basic structure marxism repeats evolution marxist theory adhered religiously zealots fervor case special form property center theory liberation man depends abolition meant positive transcendencep pfor marx special property emcapitalem ideology emcapitalismem caricature market economies winners embourgeoisieem losers emworking classem emproletariatem awakened emclass consciousnessem structure society enforced structural emclassismem emmaterially deterministicem goal marxs economicmaterial marxism theem abolition transcendence private propertyemp pin cultural marxism special property emcultural capitalem power define set culture ideology isem cultural capitalismem form cultural dominance winners emculturally eliteem embourgeoisieem losers emthose low cultureem readily identified emworking classem awakened emcultural proletariatem awakening emclass consciousnessem includes understanding cultural mores define haves havenots society structure society enforced byem cultural hegemonyem includes emclassismem emcultural classismem emmateriallyem emstructurally deterministicem goal cultural marxism abolish existing means production cultural values establish counterhegemony favors marxism cultureproducing institutions eg family religion education media law order emabolish transcend bourgeois culture class societyemp pin critical marxism special property emacceptabilityem ideology isem positivismem meant strict rationality legalistic thinking professional circles winners emculturally eliteem emnormalem onedimensional man losers emculturally excludedem awakened emcritical theoristsem adopting emcritical consciousnessem understanding better society articulated terms existing society features existing society find dehumanizing critiqued structure society emmaterialem emculturalem emsocial classismem maintained emcommodificationem emmateriallyem emstructurally deterministicem goal emabolition existing terms society great refusalemp pin postmodern marxism onymoron special property emdiscursive dominanceem ability control ideas networks meanings understood ideology isem belief stability universality meaningem winners emsocioculturally eliteem losers emsocioculturally excludedem emmarginalizedem awakened empostmodernismem empostmodernradical skepticismem general belief meaningmaking expression power essentially consciousness power operates society meaningmaking apparatuses structure society emdiscursive structuralismem emstructurally deterministicem goal emabolition privileging meaningmakingemp pin critical race theory argue relnoopener hrefhttpsamznto3rkbhcx target_blankemrace marxismema special property emwhitenessem ideology emwhite supremacyem winners emwhitesem emwhiteadjacentsem losers empeople colorem emantiracistsem awakened emrace consciousnessem instead colorblindness structure society enforced emsystemic racismem emmateriallyem emstructurally deterministicem goal theem abolition transcendence whitenessemp pin marxian feminism special property emmalenessem ideology empatriarchyem men lead society winners emmenem losers emwomenem certain extent emhomosexual menem emfeministsem awakened emfeminist consciousnessem structure society enforced emmisogynyem emstructural sexismem emphallagocentrismemem gender normativityem andem sex essentialismem emmateriallyem multiple ways emstructurally deterministicem goal emthe abolition transcendence patriarchyemp pin queer theory special property isem normalcyem ideology isem cisheteronormativityem regarded normal straight trans winners areem cisheterosexualsem andem people pass suchem losers areem abnormalem becomeem alliesem orem queerem awakened withem queer consciousnessem structure society enforced byem homophobiaemem transphobiaem otherem bigotries normativityem emmateriallyem emstructurally deterministicem goal isem abolition transcendence normalcy normativityem ie norms socially enforced categorical expectationsp pin disability studies special property emablebodiednessem ideology emableismem general better normal ablebodied instead disabled way winners emthe ablebodiedem losers emthe disabledem disabled failure society accommodate disability fully accommodates ability realized disability way disadvantage emdisability activistsem awakened emcritical consciousness ability statusem structure society enforced emdisableismem emmateriallyem emstructurally deterministicem goal emthe abolition transcendence ableismemp pin fat studies special property emthinnessem ideology emthinnormativityem normal human body overweight fact term overweight problematic implies thinnormativity suggesting ideal weight exists winners emthe thinem losers emthe fatem embodies sizeem emfat activistsem awakened emcritical fat consciousnessem structure society enforced emfatphobiaem emhealthismem important valuable healthy emmateriallyem emstructurally deterministicem goal emthe abolition transcendence thinnormativityem expectations weight body sizep pin freirean education special property emformal educationem emliteracyem ideology educated society values emeducatedem emliterateem ways acceptable existing system winners emformally educatedem emliterateem regarded asem knowersem losers emilliterateem actually knowers right system excludes ways knowing knowledges awakened empolitical literacyem emconscientizationem process awakening theem critically consciousem orem conscientizedem awakened structure society enforced expectations emliteracyem emformal educationem emmateriallyem emstructurally deterministicem relegating underclass culture silence freire goal isem abolition transcendence formal education objective knowledgeem immediate goal reappropriation education process conscientiation humanizationp pin climate justice special property emnot impacted humancaused climate changeem ideology emenergy abundance nongreen energy sourcesem enabled emneoliberalismem emimperialismem winners emthe worldem emthe fossilfuel industryem emall privileged classesem believed suffer fewer impacts climate change losers emthe developing undeveloped worldem emeverybodyem especially emmembers ofem emoppressed classesem benefit existing energy sources suffer consequences climate change allegedly awakened emgreen activismem emblueem emclimate consciousnessem structure existing society largely enforced empetrocapitalismem runs capitalist enterprise energy abundance produced oil coal natural gas nuclear power backed emneoliberalismem regard energy policy emmaterialem emstructurally deterministicem effects goal abolition black energy reliance green energy end oil coal gas industries environmental climate justice redistribution globally according alleged climate change production damages primary objective branding sustainabilityp pwe postcolonial theory health equity cases mechanism conscious seize means production relevant domain use control force redistribution new norms work abolishing relevant form special property abolishing special access fundamental meaning abolish special property undo contribution fall man ending estrangement existence form special property attendant power dynamic producep pwhat marxism understood properly esoteric faith societal division transmutation alchemy divide unify dissolve precipitate reared head different forms lost essential character additional example grows significantly preceding especially critical marxist line bears describingp pin sustainable marxism obviously double meaning special form property emproduction capacityem general ideology emshareholder capitalismem winners emthe percentem losers emthe ninetynine percentem emespecially women gender minorities sexual minorities racial minorities residents world members marginalized groupsem activists behalf emsustainable development goalsem emunited nationsem em2030 agendaem behaving ways emesg compliantem stakeholderdetermined environmental social governance standards comprise esg compliance goal emabolish shareholder capitalismem emreplace stakeholder capitalismem sustainable inclusive capitalism actually capitalism marketcontaining command economy unlike china ccpp h3the wordh3 pits time understand marxism cultreligious ideology transforming world eden undoing fall man producing stratified power dynamics allegedly selfgranted access special property arises singular error inability perceive legitimacy legitimate hierarchy proceeds means ignorant destructive envy matter form special property consideration fruits restoring liberty goodness lives depends understanding thisp pthe post relnofollow hrefhttpsnewdiscoursescom202210manyfacesofmarxismthe faces marxisma appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap

633cb4bec1fe0b956fc76fe4

Biden bashes University of Idaho policy on contraception: 'What century are we in?'

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden on tuesday bashed the university of idaho over its new guidance against offering birth control for students arguing contraception shouldnt be controversial in this day and agep pfolks what century are we in what are we doing i respect everyones view on this personal decision they make but my lord were talking about contraception here it shouldnt be that controversial biden said during a meeting of the white house task force on reproductive healthcare accessp pthis is what it looks like when you start to take away the right of privacy the president addedp pthe new policy by the university of idaho also advises employees not to speak about reproductive rights at work and warns they could face a felony conviction for promoting abortion a relnoreferrer noopener hrefhttpswwwwashingtonpostcompolitics20220926uidahomaystopprovidingbirthcontrolundernewabortionlaw target_blankthe washington post reportedap pbiden said that education secretary miguel cardona will look at steps to protect college students and school employees in idaho or other states where access to contraception is at riskp pthe policy follows idahos trigger ban which went into effect months after the supreme court overturned roe v wade and prohibits abortion after conception except when the mothers life is in danger or in instances of rape or incest if the crime is reportedp pbiden and vice president harris both attended the second meeting of the white house task force on reproductive healthcare access which came about 100 days after the supreme courts rulingp pbiden warned other universities to not enact the same policiesp pmy message to any other colleges considering enacting policies like this dont please dont were not going to sit by and let republicans throughout the country enact extreme policies to threaten access to basic health care and thats why were all here today he saidp pbiden offered support in his remarks for people during the postroe erap pmy message to folks across the country who are worried about what were seeing is first that we have your back were not going to step back from this and second weve heard your voices he saidp pthe administration on tuesday a relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3672828bidenadministrationprovidesover6mingrantstoprotectreproductivehealthcare target_blankannounced it will providea more than 6 million in new title x grants and other grants to protect access to reproductive health care and the department of education is set to release guidance to universities that will reiterate the title ix requirement that institutions must protect their students from discrimination based on pregnancy including pregnancy terminationp

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden tuesday bashed university idaho new guidance offering birth control students arguing contraception shouldnt controversial day agep pfolks century respect everyones view personal decision lord talking contraception shouldnt controversial biden said meeting white house task force reproductive healthcare accessp pthis looks like start away right privacy president addedp pthe new policy university idaho advises employees speak reproductive rights work warns face felony conviction promoting abortion relnoreferrer noopener hrefhttpswwwwashingtonpostcompolitics20220926uidahomaystopprovidingbirthcontrolundernewabortionlaw target_blankthe washington post reportedap pbiden said education secretary miguel cardona look steps protect college students school employees idaho states access contraception riskp pthe policy follows idahos trigger ban went effect months supreme court overturned roe v wade prohibits abortion conception mothers life danger instances rape incest crime reportedp pbiden vice president harris attended second meeting white house task force reproductive healthcare access came 100 days supreme courts rulingp pbiden warned universities enact policiesp pmy message colleges considering enacting policies like dont dont going sit let republicans country enact extreme policies threaten access basic health care thats today saidp pbiden offered support remarks people postroe erap pmy message folks country worried seeing going step second weve heard voices saidp pthe administration tuesdaya relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3672828bidenadministrationprovidesover6mingrantstoprotectreproductivehealthcare target_blankannounced provideamore 6 million new title x grants grants protect access reproductive health care department education set release guidance universities reiterate title ix requirement institutions protect students discrimination based pregnancy including pregnancy terminationp

633cb50dc1fe0b956fc76fef

White House says Biden 'intends' to run in 2024 after report he said 'I’m going to do it again'

pthe white house on tuesday reiterated that president biden intends to run again after the rev al sharpton had said that the president told him he will seek another termp psharpton reportedly told his staff at the national action network that biden privately told him in august he will be seeking another term a relnoreferrer noopener hrefhttpswwwnbcnewscompoliticswhitehousebidentellsalsharptonwillrunpresident2024rcna50556 target_blankaccording to nbc newsap pim going to do it again biden told sharpton according to an official with national action networkp pwhite house press secretary karine jeanpierre was asked if those reports were true at tuesdays briefing p pthe president has said this himself he intends to run in 2024 she said p pjeanpierre said she cant speak too much on the 2024 election because of the hatch act which prohibits executive branch employees from engaging in political activityp pi will just reiterate what the president has said many times is that the president intends to she saidp pthe white house has insisted that biden plans to run for reelection amid skepticism fueled by his relatively low approval ratings and questions about his agep plast month former white house official cedric richmond a relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3646461cedricrichmondonbiden2024hesrunning target_blanksaid definitivelya that biden will run again in 2024p phes running and were building an infrastructure for him to run and win richmond who is now a senior adviser for the democratic national committee told nbc p

pthe white house tuesday reiterated president biden intends run rev al sharpton said president told seek termp psharpton reportedly told staff national action network biden privately told august seeking term relnoreferrer noopener hrefhttpswwwnbcnewscompoliticswhitehousebidentellsalsharptonwillrunpresident2024rcna50556 target_blankaccording nbc newsap pim going biden told sharpton according official national action networkp pwhite house press secretary karine jeanpierre asked reports true tuesdays briefing p pthe president said intends run 2024 said p pjeanpierre said cant speak 2024 election hatch act prohibits executive branch employees engaging political activityp pi reiterate president said times president intends saidp pthe white house insisted biden plans run reelection amid skepticism fueled relatively low approval ratings questions agep plast month white house official cedric richmonda relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3646461cedricrichmondonbiden2024hesrunning target_blanksaid definitivelyathat biden run 2024p phes running building infrastructure run win richmond senior adviser democratic national committee told nbcp

633cb76dc1fe0b956fc77054

Is the Far-Right Really So Far?

img altis the farright really so far srchttpswisdomofcrowdslivecontentimages202210107638absdl1jpgpwither the farright apparently not the fact that the farright is doing better than anyone might have imaginedin italy and sweden no lesssuggests that such parties may not in fact be emon emthe farright they are increasingly mainstream and popular which suggests that they can no longer be considered on the fringes of the ideological or political spectrum or to put it differently if one still wishes to locate them on the farright of a traditional leftright plot it indicates something perhaps more troublingthat a growing number of voters have moved in their direction rather than the other way around the center has veered sharply to the rightppif the center insists on being this volatile then it calls into question the wisdom of crowds this is emtheem animating question of my a hrefhttpswwwamazoncomproblemdemocracyamericamiddleeastdp0197579469linkcodesl1tagshtwitter20linkide6539e6f131501ee78245ea7ad3d7625languageen_usref_as_li_ss_tlnew booka on the problem of democracy what do we do when democracy produces bad outcomes the thing about not only the a hrefhttpswisdomofcrowdslivewhatiswisdomofcrowdswisdom of crowdsa but just plainold wisdom is that its supposed to accumulate over time and in light of experience this is why we associate wisdom with old people and gray hair of course there are counterexamples take morrisey a hrefhttpswwwlatimescomentertainmentartsmusicstory20210510vanmorrisonlatestrecordprojectantisemitismcoronavirusvan morrisona eric clapton or a hrefhttpswwwtheguardiancombooks2015mar06kingsleyamisirritationendingupmartincraigbrownkingsley amisa each of whom settled into irascible reactionary poses as the decades passed or maybe its just an old embritishem person thing ppsimilarly in the case of italy the weight of experience has emnotem had as much of a chastening effect as observers might have hoped pdiv dataplaceholdersubscribedivpit is difficult to overstate just how remarkable the results of italys a hrefhttpswwwnytimescom20220925worldeuropeitalymeloniprimeministerhtmlseptember 25th electionsa happened to be the brothers of italyit seems reasonable to assume that any group with brothers or brotherhood in its name is not on the leftwon a clear plurality with 26 percent of the popular vote just four years ago they were an afterthought having won only around 4 percent for the first time in the postwar era italy is likely to have a farright prime minister as part of a coalition government that includes yet another farright party the league which came in third it is also worth noting that despite being the leader of the brothers of italy georgia meloni is not herself technically a brother which means she would be italys first ever female prime minister to boot ppitaly has had a rather vigorous rightwing party scene for some time now with the league having been part of an a hrefhttpswwwbrookingseduarticleshowitalysallpopulistgovernmentviewsmuslimsallpopulist governmenta from 2018 to 2019 after it came second in the 2018 elections and thats even before mentioning forza italia led by the quite trumpy sylvio berlusconi during its brief time in government the league performed unimpressivelyit seems hard to govern impressively almost anywhere these days this in turn reminded italians of the utility of having a nonpartisan technocratic prime minister with expertise in managing the economy as economists a hrefhttpswwwcnbccom20220117draghieffecthowitalyeconomyhaschangedhtmltell ita that somewhat colorless technocratmario draghi also known as a hrefhttpswwwnprorg202207261113854621supermariomeetshismatchinitalysuper marioaperformed admirably but apparently not admirably enough for voters to remain content ppitalys devastating experience with covid probably impressed upon voters the importance of having a steady if unexciting hand guiding the affairs of state i remember thinking a hrefhttpswwwtheatlanticcomideasarchive202003coronaviruskilledrevolution608680something similara at the start of the pandemic in times of crisis stability seems all the more appealing im not the biggest joe biden fan but i thank the lord that bidens in charge while a war in ukraine rages and confrontation intensifies with china there is something to be said for the idea if not necessarily the reality of competence but this is clearly not a universal inclination however entertaining it might be i generally find politics exhausting so im not sure id have much tolerance for farright leadership no matter how bad a biden or draghi happen to be many americans and italians differ however for them crisis means opportunity including the opportunity for something new and even radical ppthe thing about new things is that they dont stay new im not sure about americans but i wouldnt be surprised if italians start missing a certain super marioppbrp

img altis farright far srchttpswisdomofcrowdslivecontentimages202210107638absdl1jpgpwither farright apparently fact farright better imaginedin italy sweden lesssuggests parties fact emon emthe farright increasingly mainstream popular suggests longer considered fringes ideological political spectrum differently wishes locate farright traditional leftright plot indicates troublingthat growing number voters moved direction way center veered sharply rightppif center insists volatile calls question wisdom crowds emtheem animating question hrefhttpswwwamazoncomproblemdemocracyamericamiddleeastdp0197579469linkcodesl1tagshtwitter20linkide6539e6f131501ee78245ea7ad3d7625languageen_usref_as_li_ss_tlnew booka problem democracy democracy produces bad outcomes thing hrefhttpswisdomofcrowdslivewhatiswisdomofcrowdswisdom crowdsa plainold wisdom supposed accumulate time light experience associate wisdom old people gray hair course counterexamples morrisey hrefhttpswwwlatimescomentertainmentartsmusicstory20210510vanmorrisonlatestrecordprojectantisemitismcoronavirusvan morrisona eric clapton hrefhttpswwwtheguardiancombooks2015mar06kingsleyamisirritationendingupmartincraigbrownkingsley amisa settled irascible reactionary poses decades passed maybe old embritishem person thing ppsimilarly case italy weight experience emnotem chastening effect observers hoped pdiv dataplaceholdersubscribedivpit difficult overstate remarkable results italys hrefhttpswwwnytimescom20220925worldeuropeitalymeloniprimeministerhtmlseptember 25th electionsa happened brothers italyit reasonable assume group brothers brotherhood leftwon clear plurality 26 percent popular vote years ago afterthought having won 4 percent time postwar era italy likely farright prime minister coalition government includes farright party league came worth noting despite leader brothers italy georgia meloni technically brother means italys female prime minister boot ppitaly vigorous rightwing party scene time league having hrefhttpswwwbrookingseduarticleshowitalysallpopulistgovernmentviewsmuslimsallpopulist governmenta 2018 2019 came second 2018 elections thats mentioning forza italia led trumpy sylvio berlusconi brief time government league performed unimpressivelyit hard govern impressively days turn reminded italians utility having nonpartisan technocratic prime minister expertise managing economy economists hrefhttpswwwcnbccom20220117draghieffecthowitalyeconomyhaschangedhtmltell ita somewhat colorless technocratmario draghi known hrefhttpswwwnprorg202207261113854621supermariomeetshismatchinitalysuper marioaperformed admirably apparently admirably voters remain content ppitalys devastating experience covid probably impressed voters importance having steady unexciting hand guiding affairs state remember thinking hrefhttpswwwtheatlanticcomideasarchive202003coronaviruskilledrevolution608680something similara start pandemic times crisis stability appealing im biggest joe biden fan thank lord bidens charge war ukraine rages confrontation intensifies china said idea necessarily reality competence clearly universal inclination entertaining generally find politics exhausting im sure id tolerance farright leadership matter bad biden draghi happen americans italians differ crisis means opportunity including opportunity new radical ppthe thing new things dont stay new im sure americans wouldnt surprised italians start missing certain super marioppbrp

633e0633988604ca81cfb9a0

Biden, DeSantis project unity in response to Hurricane Ian

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden and florida gov ron desantis r put their political rivalry on hold wednesday as the two toured damage from hurricane ian and projected a sense of unity in vowing to help the hardesthit parts of the state rebuildp ptoday we have one job and only one job that is to make sure the people of florida get everything they need to fully recover biden said in prepared remarks as desantis stood behind himp pasked about desantiss response to the storm biden told reporters i think hes done a good job we have very different political philosophies but weve worked hand in glovep pbiden and desantis emphasized the cooperation between the federal government and state and local officials highlighting emergency declarations and the allocation of federal resources that allowed for a prompt response to the storm before it even made landfallp pwe were very fortunate to have good coordination with the white house and fema [the federal emergency management agency] from the very beginning of this desantis saidp pthe two men were in fort myers one of the areas that sustained the most damage when hurricane ian made landfall last week as a category 4 storm that destroyed homes and left millions without power state and local officials warned rebuilding would be a yearslong process in some areasp pbiden received a briefing on the response and recovery efforts from desantis and fema administrator deanne criswell and met with residents and smallbusiness owners impacted by the storm biden also met with florida sens rick scott r and marco rubio r as well as rep byron donalds rp pbefore arriving biden issued an amended disaster declaration that doubled the eligibility window for fully covered federal aid from 30 days to 60 days in his remarks he spoke about federal aid to provide temporary housing insurance assistance food water and other critical suppliesp pdesantis meanwhile repeatedly thanked the federal government as a whole for cutting through red tape to expedite assistance before during and after the storm made landfallp pthe white house has downplayed any tension between biden and desantis or whether other political disagreements would overshadow the meeting on wednesday wary of shifting attention away from the hurricane response the president last week called their political rivalry irrelevant during the emergencyp pthe two leaders have spoken multiple times on the phone over the past week about hurricane ian wednesday was also not the first time the two leaders have been in person together biden and desantis met in july 2021 after the deadly condo collapse in surfside fla that killed roughly 100 peoplep pbiden and desantis could face one another in a potential 2024 presidential election desantis is seen as a contender should he run for his partys nomination although former president trumps plans could be a factor in the florida governors decision p pdesantis who is up for reelection to a second term in november has raised his national profile recently and leaned into culture war issues last month by flying migrants from texas to marthas vineyard massp pscott and rubio are two other republicans who are at odds with the biden administration scott the chief of the senate gops campaign team has been bashed by biden over his tax plan and has been a consistent foil for biden in speeches rubio who is up for reelection this year has criticized the administration on its handling of multiple issues from immigration to abortion rightsp pdesantis biden first lady jill biden and floridas first lady casey desantis all greeted each other with handshakesp pformer new jersey gov chris christie r felt the ire of republicans in 2012 after photographers captured pictures of him shaking hands with thenpresident obama who put his hand on the governors shoulder the former governor was repeatedly put on the defensive during the 2016 gop presidential primary for embracing obamap pbiden earlier this week visited puerto rico in the wake of hurricane fiona a visit that was compared with former president trumps visit to the us territory after the devastation from hurricane maria in 2017p pthe president sought to contrast his support for puerto rico with the trump administrations response and has emphasized that he has the plight of puerto rico in mind even as much of the nations attention has shifted to florida and damage from hurricane ianp

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden florida gov ron desantis r political rivalry hold wednesday toured damage hurricane ian projected sense unity vowing help hardesthit parts state rebuildp ptoday job job sure people florida need fully recover biden said prepared remarks desantis stood himp pasked desantiss response storm biden told reporters think hes good job different political philosophies weve worked hand glovep pbiden desantis emphasized cooperation federal government state local officials highlighting emergency declarations allocation federal resources allowed prompt response storm landfallp pwe fortunate good coordination white house fema [the federal emergency management agency] beginning desantis saidp pthe men fort myers areas sustained damage hurricane ian landfall week category 4 storm destroyed homes left millions power state local officials warned rebuilding yearslong process areasp pbiden received briefing response recovery efforts desantis fema administrator deanne criswell met residents smallbusiness owners impacted storm biden met florida sens rick scott r marco rubio r rep byron donalds rp pbefore arriving biden issued amended disaster declaration doubled eligibility window fully covered federal aid 30 days 60 days remarks spoke federal aid provide temporary housing insurance assistance food water critical suppliesp pdesantis repeatedly thanked federal government cutting red tape expedite assistance storm landfallp pthe white house downplayed tension biden desantis political disagreements overshadow meeting wednesday wary shifting attention away hurricane response president week called political rivalry irrelevant emergencyp pthe leaders spoken multiple times phone past week hurricane ianwednesday time leaders person biden desantis met july 2021 deadly condo collapse surfside fla killed roughly 100 peoplep pbiden desantis face potential 2024 presidential election desantis seen contender run partys nomination president trumps plans factor florida governors decision p pdesantis reelection second term november raised national profile recently leaned culture war issues month flying migrants texas marthas vineyard massp pscott rubio republicans odds biden administration scott chief senate gops campaign team bashed biden tax plan consistent foil biden speeches rubio reelection year criticized administration handling multiple issues immigration abortion rightsp pdesantis biden lady jill biden floridas lady casey desantis greeted handshakesp pformer new jersey gov chris christie r felt ire republicans 2012 photographers captured pictures shaking hands thenpresident obama hand governors shoulder governor repeatedly defensive 2016 gop presidential primary embracing obamap pbiden earlier week visited puerto rico wake hurricane fiona visit compared president trumps visit territory devastation hurricane maria 2017p pthe president sought contrast support puerto rico trump administrations response emphasized plight puerto rico mind nations attention shifted florida damage hurricane ianp

633e068e988604ca81cfb9ae

OnlySubs: The Defining Ignorance of the Left

pemonlysubs episode 109 the defining ignorance of the leftspan datatagposttitle spanemis now available exclusively for new discourses contributors on the following platformsbr a relnoopener hrefhttpsnewdiscourseslocalscompost2840479thedefiningignoranceoftheleftonlysubswithjameslindsayep109 target_blanklocalsabr a relnoopener hrefhttpswwwpatreoncompostsdefiningofleft72922991 target_blankpatreonabr a relnoopener hrefhttpswwwsubscribestarcomposts718976 target_blanksubscribestarabr a relnoopener hrefhttpsnewdiscoursessubstackcompthedefiningignoranceoftheleft target_blanksubstackabr a relnoopener hrefhttpsyoutubewpywnqgfhag target_blankyoutube membersabr a relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesthedefiningignoranceoftheleftonlysubswithjameslindsayep109xqudzv5event target_blankthinkspotap pif we boil it down to brass tacks theres one key defining characteristic that places people on the left and thats the desire to do away with all hierarchy where does this desire come from i would argue that its precursor is obvious its an inability to understand when hierarchy is legitimate and therefore a belief that all hierarchy is unjust and unfair when combined with an inherent and inflated belief in their own superiority and right to rule this attitude about all hierarchy that excludes them from power explains the left almost completely in this episode of james lindsay onlysubs my subscribersonly podcast i run through this idea that the key and defining ignorance of the left from which all leftism flows is the inability to understand the legitimacy in legitimate hierarchies join me and think through it with mep padditional episodes of the emonlysubs podcastem can be found a hrefhttpsnewdiscoursescomtagonlysubshereap pthe post a relnofollow hrefhttpsnewdiscoursescom202210onlysubsdefiningignorancetheleftonlysubs the defining ignorance of the lefta appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap

pemonlysubs episode 109 defining ignorance leftspan datatagposttitlespanemis available exclusively new discourses contributors following platformsbr relnoopener hrefhttpsnewdiscourseslocalscompost2840479thedefiningignoranceoftheleftonlysubswithjameslindsayep109 target_blanklocalsabr relnoopener hrefhttpswwwpatreoncompostsdefiningofleft72922991 target_blankpatreonabr relnoopener hrefhttpswwwsubscribestarcomposts718976 target_blanksubscribestarabr relnoopener hrefhttpsnewdiscoursessubstackcompthedefiningignoranceoftheleft target_blanksubstackabr relnoopener hrefhttpsyoutubewpywnqgfhag target_blankyoutube membersabr relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesthedefiningignoranceoftheleftonlysubswithjameslindsayep109xqudzv5event target_blankthinkspotap pif boil brass tacks theres key defining characteristic places people left thats desire away hierarchy desire come argue precursor obvious inability understand hierarchy legitimate belief hierarchy unjust unfair combined inherent inflated belief superiority right rule attitude hierarchy excludes power explains left completely episode james lindsay onlysubs subscribersonly podcast run idea key defining ignorance left leftism flows inability understand legitimacy legitimate hierarchies join think mep padditional episodes emonlysubs podcastem found hrefhttpsnewdiscoursescomtagonlysubshereap pthe post relnofollow hrefhttpsnewdiscoursescom202210onlysubsdefiningignorancetheleftonlysubs defining ignorance lefta appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap

633e0729988604ca81cfb9c5

Why cheating in chess does not pay

pcheating is bad enough in any game but it is anathema to chess in so far as the game has a rationale however recondite it is the pursuit of truth the grandest of grandmasters emanuel lasker put it like this on the chessboard lies and hypocrisy do not survive long the creative combination lays bare the presumption of a lie the merciless fact culminating in the checkmate contradicts the hypocritep phence the accusation of cheating at the highest level emanating from the current world champion has not merely scandalised the wider world but called into question the emraison dtreem of this supremely gladiatorial battle of witsp pi believe that cheating in chess is a big deal and an existential threat to the game magnus carlsen declared justifying his refusal to play hans niemann the young american who had sensationally defeated him at the elite sinquefield cup tournament on 4 septemberp pcarlsen 31 who has held the world title for nine years quit the tournament and hinted that niemann 19 had received computer assistance at the board when he faced his rival again in an online tournament carlsen resigned after just one move implying that playing a cheat was beneath his dignityp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomculturetvradio202101howqueensgambitinspiredgreatchessrevival target_blankhow the queens gambit inspired a great chess revivala]emstrongp pthen on 26 september he issued a statement alleging that niemann who has admitted cheating online several years ago has cheated more and more recently than he has publicly admitted even now however carlsen claims that he is limited in what he can say without niemanns explicit permission to speak openly presumably he fears litigation rightly the reputations of chess masters are fragile so too are their egosp pthe rarefied world of grandmaster chess is now bitterly divided many have taken the side of the accused where they ask is the evidence shouldnt carlsen have provided chapter and verse before trashing the career of an unknown teenager for the former world champion garry kasparov carlsen who had been unbeaten in 53 games was just a bad loser for the british grandmaster nigel short its death by innuendop pcarlsens camp cites niemanns previous admission of cheating in online chess albeit only twice aged 13 and 16 niemann is now banned from chesscom the worlds largest chess website according to carlsen throughout our game at the sinquefield cup i had the impression that he wasnt tense or even concentrating on the game in critical positions while outplaying me as black in a way i think only a handful of players can dop phow though could niemann have had computer advice sent to him during a game given that phones and other electronic devices are banned from tournament playing areas this is where the controversy takes a salacious turn flying around social media has been the claim that niemann may have used a sex toy vibrating anal beads that could be controlled wirelessly to have moves transmitted while evading detection there is no proof that he made use of such a method but niemann himself took it seriously enough to declare if they want me to strip fully naked i will do it i dont care because i know i am cleanp pthe carlsenniemann cheating saga will doubtless have more twists before it is resolved meanwhile it is a reminder of the unique hold that chess exercises upon our cultural imaginationp pthe game was already several centuries old when the vikings brought it to britain and bequeathed us the marvellous chessmen found on the isle of lewis in his essay the glorious and bloody game arthur koestler who considered himself a passionate duffer at chess recounts a tale from emst olafs sagaem about king canute who could no more command the 64 squares than he could the waves when playing ulf one of his earls canute blundered a knight then retracted the move and made another in other words the king cheated ulf was so angry that he overturned the board in his rage fearing the royal wrath he took sanctuary in a church only to be butchered by canutes henchmenp pchess is a wargame and its aim is indeed murderous checkmate is a corruption of a persian phrase meaning the king is dead but its whole purposeem emis to sublimate violence perhaps this subtext explains the number of bloodthirsty conquerors who have succumbed to the charms of chess from charlemagne to tamburlaine the great to napoleon bonapartep pin our time the uniquely exalted status of chess in the soviet union enabled it to become a substitute for nuclear war for all the speculation about vladimir putins skill at chess the truth is that he is merely a bad poker player with tragic consequences for ukraine and the entire worldp pchess is a test of the intellect not merely of low cunning no other game has had so many books devoted to it none has inspired fiction of the quality of stefan zweigs emthe royal gameem nabokovs emthe luzhin defence emor elias canettis emautodafem to marcel duchamp chess was a higher vocation than art on his honeymoon he paid more attention to the game than to his bride in revenge she glued his pieces to the board divorce ensuedp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomculturefilm202210blondenetflixreviewdegradationmarilynmonroe target_blankthe degradation of marilyn monroea]emstrongp pscientists too from albert einstein to alan turing have paid homage to the tantalisingly elusive relationship of chess to mathematics codes and computing most recently the british artificial intelligence researcher and entrepreneur demis hassabis has penetrated more deeply into its mysteries than ever before his team at deepmind have created a chess programme alphazero that goes far beyond anything even imaginable in 1950 when claude shannons pioneering paper programming a computer for playing chess was published the gap in playing strength between humans and machines is now immeasurable hence the stakes are high in the carlsenniemann affairp pwhen my own love affair with chess began as a boy among my mentors was the emnew statesmanems chess correspondent heinrich fraenkel his columns written under the pseudonym assiac were an eclectic mlange of anecdote and analysis by a germanjewish migr who when i enthused about a performance of brecht and weils emthreepenny operaem replied ja danny i was at the first production in berlinp pin the halfcentury since i have been blessed to have played amateurs from michael foot at a emnew statesmanememtribuneem cricket match to the soviet dissident natan sharansky and grandmasters from kasparov to jon speelman nobody should be intimidated by its complexity let alone by vanishingly rare cases of cheating you can play chess for fun as well as for blood the frontispiece of assiacs book emthe pleasures of chessem has a diagram of the chessboard before a move has been made with the caption the most difficult position of all underneath the author has inscribed the book to me in his spidery hand not all that difficult after all p pemdaniel johnson is the author of white king and red queen how the cold war was fought on the chessboard atlanticemp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomculturebooks202210thecuttingwitofalanrickman target_blankthe cutting wit of alan rickmana]emstrongp

pcheating bad game anathema chess far game rationale recondite pursuit truth grandest grandmasters emanuel lasker like chessboard lies hypocrisy survive long creative combination lays bare presumption lie merciless fact culminating checkmate contradicts hypocritep phence accusation cheating highest level emanating current world champion merely scandalised wider world called question emraison dtreem supremely gladiatorial battle witsp pi believe cheating chess big deal existential threat game magnus carlsen declared justifying refusal play hans niemann young american sensationally defeated elite sinquefield cup tournament 4 septemberp pcarlsen 31 held world title years quit tournament hinted niemann 19 received computer assistance board faced rival online tournament carlsen resigned implying playing cheat beneath dignityp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomculturetvradio202101howqueensgambitinspiredgreatchessrevival target_blankhow queens gambit inspired great chess revivala]emstrongp pthen 26 september issued statement alleging niemann admitted cheating online years ago cheated recently publicly admitted carlsen claims limited niemanns explicit permission speak openly presumably fears litigation rightly reputations chess masters fragile egosp pthe rarefied world grandmaster chess bitterly divided taken accused ask evidence shouldnt carlsen provided chapter verse trashing career unknown teenager world champion garry kasparov carlsen unbeaten 53 games bad loser british grandmaster nigel short death innuendop pcarlsens camp cites niemanns previous admission cheating online chess albeit twice aged 13 16 niemann banned chesscom worlds largest chess website according carlsen game sinquefield cup impression wasnt tense concentrating game critical positions outplaying black way think handful players dop phow niemann computer advice sent game given phones electronic devices banned tournament playing areas controversy takes salacious turn flying social media claim niemann sex toy vibrating anal beads controlled wirelessly moves transmitted evading detection proof use method niemann took seriously declare want strip fully naked dont care know cleanp pthe carlsenniemann cheating saga doubtless twists resolved reminder unique hold chess exercises cultural imaginationp pthe game centuries old vikings brought britain bequeathed marvellous chessmen found isle lewis essay glorious bloody game arthur koestler considered passionate duffer chess recounts tale emst olafs sagaem king canute command 64 squares waves playing ulf earls canute blundered knight retracted words king cheated ulf angry overturned board rage fearing royal wrath took sanctuary church butchered canutes henchmenp pchess wargame aim murderous checkmate corruption persian phrase meaning king dead purposeem emis sublimate violence subtext explains number bloodthirsty conquerors succumbed charms chess charlemagne tamburlaine great napoleon bonapartep pin time uniquely exalted status chess soviet union enabled substitute nuclear war speculation vladimir putins skill chess truth merely bad poker player tragic consequences ukraine entire worldp pchess test intellect merely low cunning game books devoted inspired fiction quality stefan zweigs emthe royal gameem nabokovs emthe luzhin defence emor elias canettis emautodafem marcel duchamp chess higher vocation art honeymoon paid attention game bride revenge glued pieces board divorce ensuedp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomculturefilm202210blondenetflixreviewdegradationmarilynmonroe target_blankthe degradation marilyn monroea]emstrongp pscientists albert einstein alan turing paid homage tantalisingly elusive relationship chess mathematics codes computing recently british artificial intelligence researcher entrepreneur demis hassabis penetrated deeply mysteries team deepmind created chess programme alphazero goes far imaginable 1950 claude shannons pioneering paper programming computer playing chess published gap playing strength humans machines immeasurable stakes high carlsenniemann affairp pwhen love affair chess began boy mentors emnew statesmanems chess correspondent heinrich fraenkel columns written pseudonym assiac eclectic mlange anecdote analysis germanjewish migr enthused performance brecht weils emthreepenny operaem replied ja danny production berlinp pin halfcentury blessed played amateurs michael foot emnew statesmanememtribuneem cricket match soviet dissident natan sharansky grandmasters kasparov jon speelman intimidated complexity let vanishingly rare cases cheating play chess fun blood frontispiece assiacs book emthe pleasures chessem diagram chessboard caption difficult position underneath author inscribed book spidery hand difficult p pemdaniel johnson author white king red queen cold war fought chessboard atlanticemp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomculturebooks202210thecuttingwitofalanrickman target_blankthe cutting wit alan rickmana]emstrongp

633f57c9ce3d49997ae369f1

A California Law Designed To Protect Children's Digital Privacy Could Lead to Invasive Age Verification

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_376985552400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_376985551200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_37698555600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_37698555331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_376985552400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_376985551200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_37698555600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_37698555331x186jpg 331w img width1200 alta young girl uses a laptop alone in a dark room srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpg height675 picture div pthe california ageappropriate design code act was a hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273signeda last month by california gov gavin newsom d the law requires that online businesses create robust privacy protections for users under 18p phowever a hrefhttpswwwwiredcomstorycaliforniaaadckidsprivacyagecheckscriticsastrong strongof the law have raised a hrefhttpscapitolweeklynettheplantoblowuptheinternetostensiblytoprotectkidsonlineconcernsa about its vague language which leaves unclear what kinds of business might be subject to the laws constraints and what specific actions companies must take to comply with the lawp pfor instance due to the laws strict age requirements online businesses may resort to invasive age verification regimessuch as facescanning or checking governmentissued ids while digital privacy protections are important particularly for children californias ageappropriate design code act could have unintended consequences in its vague sweeping attempt to accomplish that endp pspanthespan a hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273spanlawspanaspan applies to any quotbusiness that provides an online service product or feature likely to be accessed by childrenquot and mandates that these businesses act in the quotbest interests of childrenquot tspanspanech companies must conduct a rigorous data protection impact assessment judging whether their products have the potential to quotharmquot children further businesses must estimate the age of child users configure childrens default settings to have a high level of privacy and provide and enforce privacy policies and other information in childfriendly language the law also mandates that businesses make it obvious to children when they are being monitored or locationtracked by a parent guardian or any other consumer and provide accessible means for children or their guardians to report privacy concernsspanp pspanbusinesses are banned from collecting using selling or sharing childrens personal informationincluding geolocationwithout a quotcompelling reasonquot or gathering information estimating the childs age range in a way that is not quotproportionatequot to the quotrisksquot of the online service the law does not clarify what makes a quotcompelling reasonquot for collecting information or how businesses should gauge whether their data collection practices are quotproportionatequot to the apparent quotrisksquot of their productbr spanp pspanfurther the law says businesses are prohibited from using quotdark patternsquot to encourage children to share unnecessary personal information or take actions that the company should know are detrimental to the childs mental and physical health spanp pspanfinally the law prevents businesses from using childrens personal information in a way it quotknows or has reason to know is materially detrimental to the physical health mental health or wellbeing of a childquotspanp pspanbusinesses that flout thespan a hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273spanlawspanaspan face fines of up to 2500 per affected child for quotnegligentquot violations and 7500 for each quotintentionalquot violation however the bill also contains a quotright to curequot giving noncompliant companies 90 days to fix their violations and avoid financial penaltiesspanp pspancritics worry that the vague language of the law leaves businesses with no clear path to compliance quotthe requirement that companies consider the best interests of children is incredibly difficult to interpretquot technet a tech sector lobbying group and the chamber of commercespan a hrefhttpswwwnytimescom20220830businesscaliforniachildrenonlinesafetyhtmlauthlinkedgoogle1taploginemailauthloginemailspanwrotespanaspan to california legislatorsspanp pspanquotas currently written we believe that the standard businesses are asked to considerthe best interests of childrenis too vague and perhaps incoherentquot a hrefhttpsreasoncomwpcontentuploads20221020220914effrequestforvetoletterreab2273pdfwrotea electronic frontier foundation senior legislative activist hayley tsukayama in a letter to gov newsom quotno service provider that operates with any kind of scale can make such decisions for an individual child unless there is a specific case incident or set of facts any service provider that operates with any kind of scale will face many different groups of children with different vulnerabilities there will always be reasonable disagreements about whats best in this larger contextquotspanp pspanfurther many critics are concerned that the bill could lead to complex and invasive age verification schemes quotpostaadc users will first be required to prove their age before they can visit any new siteeven if they just plan to visit for a second and even if they never plan to returnquotspan a hrefhttpscapitolweeklynettheplantoblowuptheinternetostensiblytoprotectkidsonlinespanwrotespanaspan eric goldman a professor at santa clara university law school in spanispanthe capitol weeklyspanispan about the measure quotthe actual process of age authentication usually involves either 1 an interrogation of personal details or 2 evaluating the users face so that software can estimate the age neither process is errorfree and either imposes costs that some businesses cant afford more importantly the authentication process is highly invasivequotspanp pspaninstagram hasspan a hrefhttpswwwaxioscom20220623instagramageverificationsocialmediachildrenspanalready adoptedspanaspan such a scheme in june the site announced that if a user attempts to change their birthdate from under 18 to over 18 they will be required to prove their age with a photo of a government id a quotvideo selfiequot which will be reviewed by a facial analysis company or by having three adult mutual followers quotvouchquot that the person is over 18 ironically online businesses could soon enact invasive ageverification requirements to comply with what is supposedly a digital privacy lawspanp pthe post a relnofollow hrefhttpsreasoncom20221006acalifornialawdesignedtoprotectchildrensdigitalprivacycouldleadtoinvasiveageverificationa california law designed to protect childrens digital privacy could lead to invasive age verificationa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_376985552400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_376985551200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_37698555600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_37698555331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_376985552400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_376985551200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_37698555600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_37698555331x186jpg 331w img width1200 alta young girl uses laptop dark room srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_37698555800x450jpg height675 picture div pthe california ageappropriate design code act hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273signeda month california gov gavin newsom d law requires online businesses create robust privacy protections users 18p phowever hrefhttpswwwwiredcomstorycaliforniaaadckidsprivacyagecheckscriticsastrongstrongof law raised hrefhttpscapitolweeklynettheplantoblowuptheinternetostensiblytoprotectkidsonlineconcernsa vague language leaves unclear kinds business subject laws constraints specific actions companies comply lawp pfor instance laws strict age requirements online businesses resort invasive age verification regimessuch facescanning checking governmentissued ids digital privacy protections important particularly children californias ageappropriate design code act unintended consequences vague sweeping attempt accomplish endp pspanthespan hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273spanlawspanaspan applies quotbusiness provides online service product feature likely accessed childrenquot mandates businesses act quotbest interests childrenquot tspanspanech companies conduct rigorous data protection impact assessment judging products potential quotharmquot children businesses estimate age child users configure childrens default settings high level privacy provide enforce privacy policies information childfriendly language law mandates businesses obvious children monitored locationtracked parent guardian consumer provide accessible means children guardians report privacy concernsspanp pspanbusinesses banned collecting selling sharing childrens personal informationincluding geolocationwithout quotcompelling reasonquot gathering information estimating childs age range way quotproportionatequot quotrisksquot online service law clarify makes quotcompelling reasonquot collecting information businesses gauge data collection practices quotproportionatequot apparent quotrisksquot productbr spanp pspanfurther law says businesses prohibited quotdark patternsquot encourage children share unnecessary personal information actions company know detrimental childs mental physical health spanp pspanfinally law prevents businesses childrens personal information way quotknows reason know materially detrimental physical health mental health wellbeing childquotspanp pspanbusinesses flout thespan hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2273spanlawspanaspan face fines 2500 affected child quotnegligentquot violations 7500 quotintentionalquot violation bill contains quotright curequot giving noncompliant companies 90 days fix violations avoid financial penaltiesspanp pspancritics worry vague language law leaves businesses clear path compliance quotthe requirement companies consider best interests children incredibly difficult interpretquot technet tech sector lobbying group chamber commercespan hrefhttpswwwnytimescom20220830businesscaliforniachildrenonlinesafetyhtmlauthlinkedgoogle1taploginemailauthloginemailspanwrotespanaspan california legislatorsspanp pspanquotas currently written believe standard businesses asked considerthe best interests childrenis vague incoherentquot hrefhttpsreasoncomwpcontentuploads20221020220914effrequestforvetoletterreab2273pdfwrotea electronic frontier foundation senior legislative activist hayley tsukayama letter gov newsom quotno service provider operates kind scale decisions individual child specific case incident set facts service provider operates kind scale face different groups children different vulnerabilities reasonable disagreements whats best larger contextquotspanp pspanfurther critics concerned bill lead complex invasive age verification schemes quotpostaadc users required prove age visit new siteeven plan visit second plan returnquotspan hrefhttpscapitolweeklynettheplantoblowuptheinternetostensiblytoprotectkidsonlinespanwrotespanaspan eric goldman professor santa clara university law school spanispanthe capitol weeklyspanispan measure quotthe actual process age authentication usually involves 1 interrogation personal details 2 evaluating users face software estimate age process errorfree imposes costs businesses cant afford importantly authentication process highly invasivequotspanp pspaninstagram hasspan hrefhttpswwwaxioscom20220623instagramageverificationsocialmediachildrenspanalready adoptedspanaspan scheme june site announced user attempts change birthdate 18 18 required prove age photo government id quotvideo selfiequot reviewed facial analysis company having adult mutual followers quotvouchquot person 18 ironically online businesses soon enact invasive ageverification requirements comply supposedly digital privacy lawspanp pthe post relnofollow hrefhttpsreasoncom20221006acalifornialawdesignedtoprotectchildrensdigitalprivacycouldleadtoinvasiveageverificationa california law designed protect childrens digital privacy lead invasive age verificationa appeared relnofollow hrefhttpsreasoncomreasoncomap

633f5840ce3d49997ae36a02

Millions of PPP Loans Were Flagged as Potentially Fraudulent. Many Were Never Investigated.

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xl_1094909162400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xl_1094909161200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xl_109490916600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xl_109490916331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xl_1094909162400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xl_1094909161200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xl_109490916600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xl_109490916331x186jpg 331w img width1200 althelicopter ppp loans srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpg height675 picture div pif the protesters who clashed with police and smashed their way through the us capitol on january 6 2021 truly wanted to quotstop the stealquot perhaps their ire should have been directed a few blocks southp pwhile the chaos was unfolding at the capitol bureaucrats at the small business administration sbathree blocks awaywere also apparently quite busy according to a hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansa new reporta some 18 million quotflagsquot applied to loans issued as part of the paycheck protection program ppp that indicated the loans might be fraudulent or otherwise incorrectly awarded were mass deleted from files on january 6p pthe mass closure of those flags paved the way for billions of dollars of ppp loan debt to be forgiven in the final days of the trump administration seemingly without due diligence on the part of the federal bureaucrats charged with preventing fraudp pin all the sba flagged nearly 23 million ppp loans worth at least 189 billion according to the report published thursday by the project on government oversight pogo a watchdog group that obtained those data from the sba via an open records request quota flagged ppp loan does not necessarily mean there was fraud but some flagsif accurateindicate clearcut reasons a recipient would have been ineligible for the taxpayerbacked loanquot the report explainsp pbut the sba has now cleared 95 percent of those loans more than 40 percent of the clearances occurred on january 6 far more than on any other single day quotthat means a substantial number of loans flagged as potentially going to fraudsters or ineligible recipients have now been forgivenquot the pogo a hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansreporta concludesp pperhaps thats why other reviews of the program have found that as much as 100 billion of the a hrefhttpswwwcovidmoneytrackerorg820 billiona distributed via ppp loans was stolen by fraudstersp pthere were 57 different types of flags applied to various ppp loans according to the report the most common one indicated that the business applying for the loan did not exist before february 15 2020the cutoff date for applicants that was supposed to prevent fraudsters from starting new businesses to collect pandemic aid that flag was applied to 785089 loansp pany loan exceeding 2 million was automatically flagged for review under a department of treasury policy adopted in 2020 to apply stricter scrutiny to the largest ppp loans but the pogo report shows that 99 percent of the roughly 28000 loans flagged for that reason were cleared during the waning days of the trump administration in january 2021p pquotthe bulk closure of most of these flagsquot the pogo report states quotsuggests that not all of these large loans received the a hrefhttpswwwcnbccom20200428smallbusinessloansabove2millionwillgetfullaudittomakesuretheyrevalidmnuchinsayshtmlfull reviewa that thentreasury secretary steven mnuchin pledged they would getquotp pthe details of the pogo a hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansreporta are worth reading in full it is an illustrative look inside a government bureaucracy that seems to have been overwhelmed by the obligation to push unprecedented piles of money out the door in the first 33 days after the ppp program was opened in april 2020 the sba lent out a hrefhttpswwwsbagovsitesdefaultfiles202005sba_oig_report_2014_508pdfmore than 20 times as mucha as it had handled in emany full yearem before that time high levels of fraud and waste were inevitablep peven when the money emdidem go to an eligible actual business much of it a hrefhttpswwwnytimescom20220201businesspaycheckprotectionprogramcostshtmlended upa in the pockets of business ownersrather than the paychecks of employeesat tremendous cost to taxpayersp pquotonly 23 to 34 percent of the programs funds went directly to workers who would have otherwise lost their jobsquot a national bureau of economic research a hrefhttpswwwnberorgsystemfilesworking_papersw29669w29669pdfstudya found another study by the federal reserve bank of st louis found that taxpayers a hrefhttpswwwstlouisfedorgpublicationsregionaleconomist2022julwaspaycheckprotectionprogrameffectivepaid roughly 4 for every 1 of wages and benefitsa to workersp pquotinitially the ppp promised loan refundability to businesses that kept workers on their payrolls for eight weeks essentially converting those loans into grantsquot emreasonems peter suderman a hrefhttpsreasoncom20220209thefederalgovernmentspandemicjobsprogramwasaresoundingfailuredetaileda in february quotbut as the pandemic dragged on and the program was topped up with additional funds the requirements slipped and the ppp eventually turned into something more like an allpurpose federally funded slush fund for small business ownersquotp pin a hrefhttpswwwsbagovsitesdefaultfiles202205sba20oig20report202213pdfa reporta published in may the sbas inspector general pointed out that the agency did not have quota centralized entity to design lead and manage fraud riskquot until february 2022nearly two years after the ppp loans began being distributed and long after the bulk of them had been forgiven thats obviously far too late to do muchp pquotthe millions of flagged ppp loans worth billions of dollarsquot the pogo report concludes quotand the lack of scrutiny leading up to their forgiveness shows the great pandemic swindle was aided and abetted by the sbas lax oversightquotp pthe post a relnofollow hrefhttpsreasoncom20221006millionsofppploanswereflaggedaspotentiallyfraudulentmanywereneverinvestigatedmillions of ppp loans were flagged as potentially fraudulent many were never investigateda appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xl_1094909162400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xl_1094909161200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xl_109490916600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xl_109490916331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xl_1094909162400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xl_1094909161200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xl_109490916600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xl_109490916331x186jpg 331w img width1200 althelicopter ppp loans srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xl_109490916800x450jpg height675 picture div pif protesters clashed police smashed way capitol january 6 2021 truly wanted quotstop stealquot ire directed blocks southp pwhile chaos unfolding capitol bureaucrats small business administration sbathree blocks awaywere apparently busy according hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansa new reporta 18 million quotflagsquot applied loans issued paycheck protection program ppp indicated loans fraudulent incorrectly awarded mass deleted files january 6p pthe mass closure flags paved way billions dollars ppp loan debt forgiven final days trump administration seemingly diligence federal bureaucrats charged preventing fraudp pin sba flagged nearly 23 million ppp loans worth 189 billion according report published thursday project government oversight pogo watchdog group obtained data sba open records request quota flagged ppp loan necessarily mean fraud flagsif accurateindicate clearcut reasons recipient ineligible taxpayerbacked loanquot report explainsp pbut sba cleared 95 percent loans 40 percent clearances occurred january 6 far single day quotthat means substantial number loans flagged potentially going fraudsters ineligible recipients forgivenquot pogo hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansreporta concludesp pperhaps thats reviews program found 100 billion hrefhttpswwwcovidmoneytrackerorg820 billiona distributed ppp loans stolen fraudstersp pthere 57 different types flags applied ppp loans according report common indicated business applying loan exist february 15 2020the cutoff date applicants supposed prevent fraudsters starting new businesses collect pandemic aid flag applied 785089 loansp pany loan exceeding 2 million automatically flagged review department treasury policy adopted 2020 apply stricter scrutiny largest ppp loans pogo report shows 99 percent roughly 28000 loans flagged reason cleared waning days trump administration january 2021p pquotthe bulk closure flagsquot pogo report states quotsuggests large loans received hrefhttpswwwcnbccom20200428smallbusinessloansabove2millionwillgetfullaudittomakesuretheyrevalidmnuchinsayshtmlfull reviewa thentreasury secretary steven mnuchin pledged getquotp pthe details pogo hrefhttpswwwpogoorginvestigation202210thegreatpandemicswindlefedsbotchedreviewofbillionsinsuspectppploansreporta worth reading illustrative look inside government bureaucracy overwhelmed obligation push unprecedented piles money door 33 days ppp program opened april 2020 sba lent hrefhttpswwwsbagovsitesdefaultfiles202005sba_oig_report_2014_508pdfmore 20 times mucha handled emany yearem time high levels fraud waste inevitablep peven moneyemdidem eligible actual business hrefhttpswwwnytimescom20220201businesspaycheckprotectionprogramcostshtmlended upa pockets business ownersrather paychecks employeesat tremendous cost taxpayersp pquotonly 23 34 percent programs funds went directly workers lost jobsquot national bureau economic research hrefhttpswwwnberorgsystemfilesworking_papersw29669w29669pdfstudya found study federal reserve bank st louis found taxpayers hrefhttpswwwstlouisfedorgpublicationsregionaleconomist2022julwaspaycheckprotectionprogrameffectivepaid roughly 4 1 wages benefitsato workersp pquotinitially ppp promised loan refundability businesses kept workers payrolls weeks essentially converting loans grantsquot emreasonems peter suderman hrefhttpsreasoncom20220209thefederalgovernmentspandemicjobsprogramwasaresoundingfailuredetaileda february quotbut pandemic dragged program topped additional funds requirements slipped ppp eventually turned like allpurpose federally funded slush fund small business ownersquotp pin hrefhttpswwwsbagovsitesdefaultfiles202205sba20oig20report202213pdfa reporta published sbas inspector general pointed agency quota centralized entity design lead manage fraud riskquot february 2022nearly years ppp loans began distributed long bulk forgiven thats obviously far late muchp pquotthe millions flagged ppp loans worth billions dollarsquot pogo report concludes quotand lack scrutiny leading forgiveness shows great pandemic swindle aided abetted sbas lax oversightquotp pthe post relnofollow hrefhttpsreasoncom20221006millionsofppploanswereflaggedaspotentiallyfraudulentmanywereneverinvestigatedmillions ppp loans flagged potentially fraudulent investigateda appeared relnofollow hrefhttpsreasoncomreasoncomap

633f5a7cce3d49997ae36a49

My Conversation with the excellent Walter Russell Mead

phere is a relnoopener hrefhttpsconversationswithtylercomepisodeswalterrussellmead target_blankthe audio and transcripta here is the summaryp blockquotephe joined tyler to discuss how the decline of american religiosity has influenced us foreign policy which american presidents best and least understood the middle east the shrewd reasons stalin supported israel the saudi secret to political stability the fate of pakistan the most likely scenario for china moving on taiwan the gun pointed at the head of german business the uss murderous fetishization of ideology over reality in subsaharan africa the inherent weakness in having a foreign policy establishment dominated by academics what he learned from attending the groton school and much morepblockquote phere is one excerptp blockquote pstrongcowen stronghow would you change or improve the training that goes into americas foreign policy elitep pstrongmead strongwell i would start by trying to draw peoples attention to that over the last 40 years theres been an enormous increase in the number of phd grads engaged in the formation of american foreign policy theres also been an extraordinary decline in the emeffectivenessem of american foreign policy we really ought to take that to heartp pstrongcowen strongdo you think of it as an emadvantageem that you dont have a phdp pstrongmead strongemhugeem advantagep pstrongcowen stronghow would you describe that advantagep pstrongmead strongi dont really believe in disciplines i see connections between things i start from reality im not trying to be antiintellectual here you need ideas to help you organize your perceptions of reality but i think theres a tendency in a lot of social science disciplines  you start from a bunch of really smart engaged people who have been thinking about a set of questions and say well do a lot better if we stop randomly thinking about everything that pops up and try in some systematic way to organize our thinking of thisp pi think you do get some gains from that but you see over time the focus of the discipline has this tendency to shift the discipline tends to become more inward navelgazing whats the history of our efforts to systematize our thinking about this the discipline becomes more and more in a sense ideological and internally focused and less pragmaticp pi think that some of the problem though is not so much in the intellectual weaknesses of a lot of conventional postgrad education but simply almost the crime against humanity of having whole generations of smart people spend the first 30 35 years of their lives in a total bubble where theyre in this academic setting and the rule    they become socialized into the academy just as much as prisoners get socialized into the routines of a prisonp pa relnoopener hrefhttpsforeignpolicycom20140315doestheacademymatter target_blank datahrefhttpsforeignpolicycom20140315doestheacademymatterthe american academy is actually a terrible place for coming to understand how world politics worksa recently i had a conversation with an american official who was very proud of the way that the us had broken the mold by revealing intelligence about russias plans to invade ukraine and pointed out how that had really helped build the nato coalition against russian aggression and so onp pso far as he goes its true but i said however if you really look at the total message the us was projecting to russia in those critical months there were two messages one is weve got great intelligence on you we actually understand you much better than you think it was shocking i think it shocked the russians but on the other hand were saying we think youre going to win quickly in ukraine were offering zelenskyy a plane ride out of kyiv were pulling out all our diplomats and urging other countries to pull out their diplomatsp pthe message actually the totality of the message that we sent to putin is you are going to win if you do thisp blockquote pand this on what makes for talent in the foreign policy arenap blockquotepyou cant know too much history a hunger for travel i think too many foreign policy types dont actually get out into the field nearly as much as they should curiosity about other cultures a strong grounding in a faith of your own which can be a secular ideology perhaps in some cases but more often is likely to be a great religious tradition of some kindpblockquote pa very good conversation  and i am happy to recommend walters new book a relnoopener hrefhttpswwwamazoncomarccovenantunitedstatesisraeldp0375414045refsr_1_1cridiqt5x3cetjqbkeywordswalterrussellmeadqid1664980592queyjxc2mioiiylji2iiwicxnhijoims40ocisinfzcci6ijeuntiifq3d3dsprefixwalterrussellmea2caps2c532sr81 target_blankthe arc of a covenant the united states israel and the fate of the jewish peopleap pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210myconversationwiththeexcellentwalterrussellmeadhtmlmy conversation with the excellent walter russell meada appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

phere relnoopener hrefhttpsconversationswithtylercomepisodeswalterrussellmead target_blankthe audio transcripta summaryp blockquotephe joined tyler discuss decline american religiosity influenced foreign policy american presidents best understood middle east shrewd reasons stalin supported israel saudi secret political stability fate pakistan likely scenario china moving taiwan gun pointed head german business uss murderous fetishization ideology reality subsaharan africa inherent weakness having foreign policy establishment dominated academics learned attending groton school morepblockquote phere excerptp blockquote pstrongcowenstronghow change improve training goes americas foreign policy elitep pstrongmeadstrongwell start trying draw peoples attention 40 years theres enormous increase number phd grads engaged formation american foreign policy theres extraordinary decline theemeffectivenessemof american foreign policy ought heartp pstrongcowenstrongdo think anemadvantageemthat dont phdp pstrongmeadstrongemhugeemadvantagep pstrongcowenstronghow describe advantagep pstrongmeadstrongi dont believe disciplines connections things start reality im trying antiintellectual need ideas help organize perceptions reality think theres tendency lot social science disciplinesyou start bunch smart engaged people thinking set questions lot better stop randomly thinking pops try systematic way organize thinking thisp pi think gains time focus discipline tendency shift discipline tends inward navelgazing whats history efforts systematize thinking discipline sense ideological internally focused pragmaticp pi think problem intellectual weaknesses lot conventional postgrad education simply crime humanity having generations smart people spend 30 35 years lives total bubble theyre academic setting rule socialized academy prisoners socialized routines prisonp pa relnoopener hrefhttpsforeignpolicycom20140315doestheacademymatter target_blank datahrefhttpsforeignpolicycom20140315doestheacademymatterthe american academy actually terrible place coming understand world politics worksa recently conversation american official proud way broken mold revealing intelligence russias plans invade ukraine pointed helped build nato coalition russian aggression onp pso far goes true said look total message projecting russia critical months messages weve got great intelligence actually understand better think shocking think shocked russians hand saying think youre going win quickly ukraine offering zelenskyy plane ride kyiv pulling diplomats urging countries pull diplomatsp pthe message actually totality message sent putin going win thisp blockquote pand makes talent foreign policy arenap blockquotepyou cant know history hunger travel think foreign policy types dont actually field nearly curiosity cultures strong grounding faith secular ideology cases likely great religious tradition kindpblockquote pa good conversation happy recommend walters new book relnoopener hrefhttpswwwamazoncomarccovenantunitedstatesisraeldp0375414045refsr_1_1cridiqt5x3cetjqbkeywordswalterrussellmeadqid1664980592queyjxc2mioiiylji2iiwicxnhijoims40ocisinfzcci6ijeuntiifq3d3dsprefixwalterrussellmea2caps2c532sr81 target_blankthe arc covenant united states israel fate jewish peopleap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210myconversationwiththeexcellentwalterrussellmeadhtmlmy conversation excellent walter russell meada appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6341fa6e8095d0e4fa93244b

Three Paths to Despotism

img altthree paths to despotism srchttpss3amazonawscomprodstaticcontentquillettecom202210gettyimages105473538jpgpppdemocracy is at stake us president biden a hrefhttpsnewsyahoocombidencitesitalyelectionwarning163245918htmltold a gatheringa of democratic party governors on september 28th his warning about the global spread of illiberalism followed the stunning gains made by populist parties in a hrefhttpswwwnytimescom20220917worldeuropeswedenfarrightelectionhtmlswedena and a hrefhttpsquillettecom20220928prepareforturbulenceitalya the latter of which he mentioned directly we cant be sanguine about whats happening here either he added biden has already called much of his own domestic opposition a hrefhttpswwwnbcnewscompolitics2022electionbidenblastsmagaphilosophysemifascismrcna44953semifascista and fears of antidemocratic violence remain following the storming of the us capitol on january 6th 2020 by rioters attempting to overturn his own election ppbut these worrying developments on the political right reflect only one expression of the new authoritarianism the western left once advocates of free speech and tolerant of markets now embrace a massive expansion of state power complete with expansive curbs on expression and speech perhaps most ominous of all expanded state power and intolerance are also now being embraced by some of the worlds most powerful corporations which have benefited greatly from liberalism the rule of law and open inquiryppbeyond the west fullbore authoritarians are already in powerxi jinping in china vladimir putin in russia and recep tayyip erdoan in turkey at the end of the cold war the world seemed to be traveling on a natural arc to a more democratic future but authoritarianism has been on the rise for almost a hrefhttpswwwnytimescom20161129worldamericaswesternliberaldemocracyhtmltwo decadesa most critically chinas rise offers an alluringat least to somemodel of a new corporate state that perhaps more than anything recalls the european fascist regimes in the 1920s and 30s democracies xi is said to have told biden cant be sustained in the 21st centuryppstronghistorical precedence and critical preconditionsstrongppautocracys appeal lies partly in the sense of certainty and enthusiastic commitment it provides in his 1995 work ema hrefhttpswwwamazoncomnazigermanyhistoryklausfischerdp0760707367nazi germany a new historyaem the historian klaus fischer argues that the 20th centurys dictatorial regimes thrived by offering a version of traditional religiosity with its own dogmas priesthood and inquisitions their preferred emterroirsem are societies experiencing economic decline and the loss of traditional social spiritual and political moorings in the 1930s radical cultural changes and depressed economic conditions fostered nationalist extremism in some places while others rejected constitutional democracy for the siren song of stalinismppwithout the depression and the sense of societal unraveling during the weimar republic it is unlikely hitler would have gained power fascism noted historian fl carsten in ema hrefhttpswwwamazoncomrisefascismsecondflcarstendp0520046439the rise of fascisma em1967 was the product of a deep economic and social crisis a crisis of european society todays social turmoil and economic decline is all too similar north america and a hrefhttpswwwftcomcontentafa8440105c641f8b8f62ded251178f8europea both face the growing threat of a serious global economic downturn today 57 percent of americans a hrefhttpswwwrasmussenreportscompublic_contentbusinessstock_market57_see_depression_aheadaccording to rasmussena worry that a major depression is on the way this belief may not be justified but it offers a snapshot of growing public anxiety and pessimismppthe generational aspect is critical here pew a hrefhttpswwwpewresearchorgglobal20180918expectationsforthefuturehas founda that 56 percent of residents in advanced economies believe their children will do worse than they did this is not an unreasonable assumptionin 2018 a hrefhttpsthirdwayimgixnetpdfshigheredsbrokenbridgetothemiddleclasspdfhalf of all recent college gradsa in the us made under 28000 annually and another recent study a hrefhttpsstradaeducationorgpressreleasepompandcircumstancesnewstudyfindsmostcollegegraduateswhostartoutunderemployedstaytheresuggests thata most underemployed graduates will remain that way permanently the frustrations of the young provide particularly effective kindling for extreme politics in prewar germany before the nazis took power notes historian frederic spotts in ema hrefhttpswwwamazoncomhitlerpoweraestheticsfredericspottsdp1468316710hitler and the power of aestheticsa em2002 national socialism was all the rage among university students and a hrefhttpswwwdwcomenhitlersoddappealtogermanyoutha16410476young peoplea in general these disgruntled youngsters also filled the ranks of the a hrefhttpswwwjstororgstable1431716communist militiasappby contrast support for marketcentered institutions and free speech tends to diminish in hard times even before the current economic woes an a hrefhttpswwwreuterscomarticleusdavosmeetingtrustcapitalismseendoingmoreharmthangoodinglobalsurveyiduskbn1zj0cwedelman surveya reported that a majority of people in 28 countries around the world said they believe that capitalism does more harm than good more than fourinfive worry about job loss particularly from automation rising inequality and general fear of downward mobility have boosted support for a hrefhttpswwwwsjcomarticlestheeraofbiggovernmentisback11624636813expanded governmenta and greater redistribution of wealthppfaith in the democratic model meanwhile has fallen steadily for almost a decade with disapproval of democracy now well over 50 percent globally a phenomenon clearly evident in a hrefhttpswwwtheamericaninterestcom20170701losingnationstatethe united statesa a 2020 a hrefhttpswwwcamacuksystemfilesreport2020_003pdfglobal survey of opiniona by the cambridgebased center for the future of democracy that combined data from over 48 million respondents43 sources in 160 countries between 1973 and 2020found faith in democracy falling most precipitously among generation x and millennialsppstrongthe revival of the populist rightstrongppthe revival of the populist right represents the clearest face of resurgent authoritarianism its illiberal parties and movements reject the basic logic of economic globalism and constitute a reaction to the perceived contempt with which many leading institutions treat national religious and family values this is made explicit in the program of a hrefhttpswwwtheguardiancomworld2022sep17giorgiamelonibrothersofitalyleaderfarrightelectionsalliancethe brothers of italyappsupport for rightwing populism has most obviously been driven by mass migration fears about which demagogues have not been slow to exploit after support for mass immigration from the middle east appeared to surge during the syrian civil war in 2015 support for a liberal border policy soon receded a year later pew research a hrefhttpswwwpewresearchorgfacttank20160916europeanopinionsoftherefugeecrisisin5chartsfound thata a median of 50 percent of respondents across 10 eu countries said immigrants were imposing a burden on their country while in no eu country surveyed did more than fourinten say that having an increasing number of people from many different races ethnic groups and nationalities makes their country a better place to live in 2018 pew a hrefhttpswwwpewresearchorgfacttank20181210manyworldwideopposemoremigrationbothintoandoutoftheircountriesfound thata 71 percent of italians almost 58 percent of germans 52 percent of swedes and 41 percent of french citizens wanted either fewer or no new immigrants a median of just 10 percent wanted morepfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202210image1png altthree paths to despotism width417 height940figurepdespite calls for mass immigration to make up for europes deepening demographic decline an a hrefhttpswwwbrusselsreporteu20220201pollrevealsgreatuneaseamongeuropeansaboutmigrationpolicyoverwhelming majoritya in virtually every european country favors stronger border controls at the eu frontier and opposes the arrival of large numbers of unskilled people indeed even as immigration has dropped due in part to the pandemic european policies towards migrants a hrefhttpswwwnytimescom20220302magazinegreecemigrationngoshtmlhave tougheneda while attitudes have a hrefhttpswwwdwcomenantiimmigrantattitudesriseworldwidepolla55024481generally hardenedappthe rise of crime associated with immigration has a hrefhttpswwwthetimescoukarticleteensroamstreetswithriflesascrimeswampsswedenq83g055k9riled oncesafe swedena which now suffers a hrefhttpswwwwsjcomarticleseuropesrightwardtrendhasreachedswedenelectionvoterscrimeimmigrationmoderatesjimmieakesson11663104023the secondhighesta rate of deadly shootings emper capitaem out of 22 european countries a hrefhttpswwwtheatlanticcomnewslettersarchive202208viktororbansracismus671039illiberal nativist politicsa have turned hungarys victor orbn into a celebrated figure on the populist right in both europe and north america some antiimmigrant movements espouse unambiguously racist views but others are inspired by opposition to the kind of openended immigration favored by the prevailing corporate and bureaucratic apparatus some have even found inspiration a hrefhttpswwweconomistcomdemocracyinamerica20170102thefarrightsnewfascinationwiththemiddleagesin the middle agesa and the example of the frankish king charles martel who defeated muslim invaders in the eighth centuryppstrongeconomic underpinningsstrongppbut its economic dislocation that will provide the populist rights resurgence with its critical fuel the key may lie with what historian eric weitz identifies as the proletarianization of the middle class in his book ema hrefhttpswwwamazoncomweimargermanypromisetragedycentennialdp0691183058weimar germany promise and tragedyaem today as in germany during the 1930s many shopkeepers farmers and artisans feel threatened by inflation and by the growing power of large corporations wall street magnates and tech oligarchs in 2020 smallbusiness owners in america were among donald trumps a hrefhttpswwwtheguardiancombusiness2020feb27smallbusinessownersdonaldtrumpsecondtermstrongest supportersa while shop owners across europe still face potentially disastrous conditionsppincreasingly neoliberalismdefined by historian gary gerstle in ema hrefhttpswwwamazoncomrisefallneoliberalorderamericadp0197519644the rise and fall of the neoliberal ordera em2022 as a creed that favors free trade and the free movement of capital goods and peopleis falling out of favor among large parts of the western population unlike traditional conservative groups but like the authoritarians of the 30s the new populist right rejects emlaissezfaireem conservatism generally supports a strong welfare state and has tended to take an anticapitalist collectivist line during its drive for power after all mussolini had once been a radical socialist and proffered fascism as meeting the demands of the working class canadian historian robert gellately a hrefhttpsreasoncom20070815hitlershandoutshas demonstrateda that socialist ideas including a planned expansion of the welfare state were also a critical element of nazi ideologyppby rejecting neoliberal dogma the populist right has been able to appeal to workingclass voters who are a hrefhttpstheliberalpatriotsubstackcompthedemocratsworkingclassvoterditching their traditional tiesa to democrats in america and a hrefhttpswwwopendemocracynetencounteringradicalrighthowfarrighttookovermainstreamto socialdemocratic partiesa across europe this workingclass shift could be accelerated by the adoption of draconian green policiesand the high energy prices they producewhich is already sparking support for rightwing populists particularly in the a hrefhttpsunherdcomthepostafdsupportsurgesineastgermanyeastern reaches of germanyappin the coming years everstricter environmental controls on households and businesses and the surge of energy prices and reliability shortfalls seem likely to spark the kind of grassroots rebellions first seen in the a hrefhttpswwwbbccomnewsworldeurope50424469emgilets jaunesema protests that swept france and a hrefhttpswwwopendemocracynetencaneuropemakeityellowvestphenomenonandradicalrightreceived sympathetic supporta across the populist right some resent seeing the welltodo a hrefhttpsnewrepubliccomarticle144199algorescarbonfootprintdoesntmatteradvertize their environmental virtuea while the policies they recommend impose extraordinarily high energy and housing costs on whole economic sectorsppthere are some differences between todays populist right and the fascists and national socialists of the 20th century while the nazis notes historian spotts enjoyed strong support among university students and the intelligentsia todays populists have little purchase among the cognitive elites nevertheless this alienated population is served by a thriving alternative media ecosystem parts of which a hrefhttpswwwmediamattersorgjanuary6insurrectionrightwingmediahavebeendismissingdownplayingandattackingjanuary6have tried to turna the malcontents of january 6th into folk heroes and martyrs the fact that stop the steal rhetoric has been adopted by a hrefhttpswwwpbsorgnewshourpoliticsnearly1in3republicancandidatesforstatewideofficesupportfalseelectionclaimsnearly a thirda of republican candidates suggests that much of that oncegreat party have embraced conspiratorial and paranoid farright persecution fantasiesppstrongfrom left liberalism to authoritarianismstrongpphistorically progressives saw themselves as the archenemies of rightwing authoritarianism and indeed many of the great accomplishments of liberalismfrom the civil rights movement to the rights for women and gayscame about in the face of stiff opposition from the reactionary right in recent decades however the left across the west has become increasingly authoritarian and intolerant of dissenting viewsppthis shift has occurred as progressives have grown to dominate many of societys most critical institutions such as academia and the media and have sought to fortify their position with the tools of authoritarianism this neartotal dominance of the cultural heights of western societies has been marked by increasing political dogmatism a penchant for censorship and contempt for those who diverge from their orthodoxies the current religion of western liberals in politics and media notes writer a hrefhttpstwittercomggreenwaldstatus1567291180974489601glenn greenwalda is censorship their prime weapon of activismppuniversities have been the prime incubators of this shift once a bastion of open inquiry higher education is now defined by ideological homogeneity particularly among a hrefhttpspjmediacomnewsandpoliticstoniairaksinen20180809studyprofslesslikelytohirenramembersrepublicansn60081the facultya this according to a hrefhttpswwwnasorgacademicquestions312homogenous_the_political_affiliations_of_elite_liberal_arts_college_facultya recent studya has been particularly true at liberal arts colleges some departments of which have become entirely republicanfreesup supthe skew is especially acute in fields that most affect public policy and opinion a hrefhttptaxproftypepadcomtaxprof_blog201808byuandpepperdinearethemostideologicallybalancedfacultiesamongthetop50lawschools2013htmlwell under 10 percent of facultya at leading law schools such as harvard yale stanford columbia and berkeleyinstitutions that graduate many of the nations leadersdescribe themselves as conservativeppsimilarly although roughly half of british voters lean to the right less than 12 percent of academics do these trends are common across europe and a hrefhttpsjournalslibraryualbertacacjsindexphpcjsarticleviewfile10363661in canadaa and the resulting imbalance has transformed much of academia into something resembling an ideological reeducation camp a hrefhttpsquillettecom20190618ablackeyeforthecolumbiajournalismreviewprominent schools of journalisma have also moved away from teaching the fundamentals of reporting in favor of advancing a social justice agendasup supeven some progressives such as the legal scholar cass sunstein a hrefhttpseuamestribcomstoryopinioncolumns20180918casssunsteinproblemwithall10265898007have acknowledgeda that students are less likely to get a good education and faculty members are likely to learn less from one another if there is a prevailing political orthodoxyppthis kind of emde factoem indoctrination combined with diminished economic prospects appear to be driving some young people into the arms of the populist left in france the socialist party which previously maintained support for free speech and free markets is now part of an alliance committed to anticapitalism and a program of enlightened social control a hrefhttpswwwpoliticoeuarticlejeanlucmelenchonrabblerouserleadernewfranceleftunder the leadershipa of jeanluc mlenchon an admirer of the late hugo chvez in this years presidential race as in 2017 those under 35 a hrefhttpswwwbfmtvcompolitiqueelectionspresidentiellepresidentielleles1834ansauraientmisjeanlucmelenchonausecondtour_av202204100362htmlfavored either the aged trotskyitea or populistright standardbearer marine le pen over technocratic centrist president emmanuel macronppsimilarly in the united states the democratic socialists of america dsa a hrefhttpswwwthenationcomarticlepoliticschicagosocialismconferencehave rejecteda the liberal elements of the old left for more draconian stances on both capitalism and property rights in the 2016 primaries the a hrefhttpsreasoncom20220913theauthoritarianconvergencepolicy agendaa of socialist bernie sanders included giving close to almost half of all corporate seats to employees and expanding federal power over all aspects of economic life he a hrefhttpswwwwashingtonpostcomnewsthefixwp20160620moreyoungpeoplevotedforberniesandersthantrumpandclintoncombinedbyalotutm_termfba92f8a3fa3easily outpolleda hillary clinton and donald trump emcombined emamong under30 voterssup supin 2020 he also did a hrefhttpswwwcityjournalorgbidenvictoriesdemocratsleftistfuturevery wella among young people even as the older cohorts decisively rejected him ppsocialism long anathema in america has gained currency among the younger generations a poll conducted by the communism memorial foundation in 2016 a hrefhttpswwwwashingtontimescomnews2017nov4majoritymillennialswantlivesocialistfascistofound thata 44 percent of american millennials favor socialism while 14 percent chose either fascism or communismsup supthe emerging left in america is also now among the most enthusiastic supporters of censorship apparently perceiving any opposition to be essentially illegitimate and caused by racism sexism or some other social dysfunction in his 2018 book ema hrefhttpswwwamazoncompeoplevsdemocracyfreedomdangerdp0674237684the people vs democracy why our freedom is in danger and how to save itaem political scientist yascha mounk reveals that while more than twothirds of older americans still embrace democracy a hrefhttpswwwtheatlanticcominternationalarchive201803yaschamounkdemocracy554786only oneinthree millennialsa do overall it is white progressives not rightwingers who constitute a hrefhttpswwwtheatlanticcompoliticsarchive201903uscountiesvarytheirdegreepartisanprejudice583072the most intolerant groupa in america and who are also far more likely a hrefhttpswwwamericansurveycenterorgresearchthestateofamericanfriendshipchangechallengesandlosslosing_a_friend_over_politicsto eschew contactsa with political opponents than any groupppstrongthe corporate authoritariansstrongpparguably the most potent if least understood authoritarian drive comes not from political populists but from the convergence of a hrefhttpsacademicoupcomrofarticle2346975477414dominant corporationsa and the bureaucratic establishment increasingly the wests economy looks more like rule by corporate giantismthe giant japanese emzaibatsuem the german prewar cartels and the big family industrial groups in mussolinis time a tenth of the us economy is made up of industries where four firms dominate more than twothirds of the market with finance and information technology now among a hrefhttpswwweconomistcomgraphicdetail20160324corporateconcentrationppccampaignid17210591673ppcadidgclsrcdsgclsrcdsthe most concentrateda europe too has experienced a steady growth in corporate concentration over the last two decadesppcapitalism has increasingly lost the competitive character that shaped its ascendence today its giants a hrefhttpswwwwsjcomarticlesgooglefacebookagreedtoteamupagainstpossibleantitrustactiondraftlawsuitsays11608612219often colludeasup supeven as they a hrefhttpswwwwsjcomarticlesfacebookmeetsappleinclashofthetechtitansweneedtoinflictpain11613192406fight among themselvesalike the emdaimyoem in medieval japan what competition remains comes from other giants rather than from plucky upstarts microsoft now controls 90 percent of all operating system software a hrefhttpswwwstatistacomstatistics242549digitaladmarketshareofmajoradsellingcompaniesintheusbyrevenuetextin25202020252c2520google2520accounted2520for252520and2520102520percent252c2520respectivelythree tech firmsa now account for twothirds of all online advertizing revenues which now represent a hrefhttpswwwforbescomsitesbradadgate20211208agenciesagree2021wasarecordyearforadspendingwithmoregrowthexpectedin2022sh6d58dbe07bc6the vast majoritya of all ad sales once paragons of entrepreneurial vigor these firms a hrefhttpsamericanaffairsjournalorg202102thepoliticsoftollboothcapitalismhave morpheda into exemplars of tollbooth capitalism and receive revenues on transactions that far exceed anything they lose in failed ventures and acquisitionsppfinance too has become markedly a hrefhttpswwwclevelandfedorgennewsroomandeventspublicationscommunitydevelopmentbriefsdb20211006hasbankconsolidationchangedpeoplesaccessaspxmore concentrateda with the number of banks in the us down a full third since 2000 while europe experiences a slower but a hrefhttpshomekpmgxxenhomeinsights202102europeanbankingconsolidationhtmlsimilar consolidationa global investing is now dominated by a handful of companies the a hrefhttpsfredstlouisfedorgseriesddoi06usa156nwdbfive largesta of which control over 45 percent of all assets in the us compared to under 30 percent 20 years ago the five largest investment banks a hrefhttpswwwstatistacomstatistics271008globalmarketshareofinvestmentbankscontrol roughly onethirda of investment funds the top 10 control an absolute majority for the most part these firms hated donald trump this partly owed to understandable revulsion at his character but it was also due to his hostility to china his opposition to the cheap labor provided by immigration and his support for efforts to break up big tech firms they therefore united to make massive contributions to electoral efforts to remove him a move a hrefhttpstimecom5936036secret2020electioncampaignlater celebrateda in emtimeem magazineppthe dominant social media players also clearly wanted biden in the white house they had little trouble covering trumps numerous lies and misdeeds but never censored some of the equally absurd antitrump conspiracies as greenwald a hrefhttpstheinterceptcom20201015facebookandtwittercrossalinefarmoredangerousthanwhattheycensorpointed outa the a hrefhttpstaibbisubstackcomptkmashupthemediacampaigntoprotectquashinga of the emnew york postems hunter biden laptop story by a hrefhttpsnypostcom20201118bigtechsfreespeechsuppressionisdangerousinformationwarfaredevinetwitter and facebooka not to mention the social media ban imposed on trump himself represented a remarkable and frightening exercise of arbitrary power although many liberals did not disapprove of these actsanything they reasoned was okay if it helped to get rid of trumpforeign observers with actual experience living under despotic regimes like german chancellor a hrefhttpsnypostcom20210112merkelworldleadersspeakoutagainsttrumpstwitterbanangela merkela and the russian dissident a hrefhttpswwwnbcnewscomnewsworldrussianoppositionleadernavalnyslamstrumpbancensorshipn1253679alexei navalnya were less impressed like donald trump the new italian prime minister has already had a viral a hrefhttpslegalinsurrectioncom202209youtuberemovesviralvideoofincomingitalianprimeministergiorgiameloniforviolatingtermsofserviceyoutube video removeda for supposedly violating the platforms community guidelinesppin contrast to the confrontations with trump the corporate elite and a hrefhttpsnypostcom20201128joebidencabinetsettingpresidencyuptobeswampthings2the biden administrationa have promised to work harmoniously to control information at emus newsem journalist robert epstein has argued that googles algorithms have made it a hrefhttpswwwusnewscomopinionarticles20160622googleistheworldsbiggestcensoranditspowermustberegulatedthe worlds biggest censora creating what jenin younes writing in emtabletem magazine a hrefhttpswwwtabletmagcomsectionsartslettersarticlesgovernmentprivatizedcensorshipregimehas calleda a privatized censorship regime as ellie mae ohagan in a hrefhttpswwwtheguardiancomcommentisfree2018mar18facebookextremistcontentuserdatathe emguardianema put it if exxonmobil attempted to insert itself into every element of our lives like this there might be a concerted grassroots movement to curb its influenceppin the coming years control of information will be used to shape public attitudes about the climate emergency the mindless dogmatism of which the emwsjems helen raleigh a hrefhttpswwwwsjcomarticlesthewestmimicsmaotakesagreenleapforwardcleanenergychinacommunismfarmingindustrializationquota11663767101has compareda to maos great leap forward last year google a hrefhttpsnewsyahoocomgooglecrackdownaffectusercontradicting182500405htmlannounced a crackdowna on climate policy skepticsincluding wellknown scientistsa policy a hrefhttpswwwwsjcomarticlesclimatecensorshipphasetwoginamccarthysocialmediabidenwhitehouse11655156191eagerly embraceda by the epas director gina mccarthy as environmental activist michael shellenberger a hrefhttpsmichaelshellenbergersubstackcompwhybidenkeepslyingaboutenergyhas pointed outa theres little appetite to be found at the major media outlets for challenging a hrefhttpsmichaelshellenbergersubstackcompdisinformationbehindcensorshiputm_sourceemailmisleading statementsa from bidens energy and environmental spokespersons another service to the current white houseppthe corporate authoritarians have also started to use their financial power to promote their preferred policies the current craze among corporate leaders particularly the big investment banks for a hrefhttpswwwrealclearenergyorgarticles20200827the_folly_of_woke_capitalism_stakeholders_and_the_future_of_american_democracy_575530htmlstakeholder capitalisma means the imposition of environmental race and gender a hrefhttpswwwnytimescom20180228opinioncorporateamericaactivismhtmlperquisitesa on investments this approach has the a hrefhttpswwwomfiforg202103bidenimpactonesginvestingwillgodeeperthanclimatestrong backinga of the administration at the same time paypal now feels free to demonetize the accounts of those with unacceptable views on such topics as climate change gender fluidity and raceppironically as the most powerful media corporate and government officials fret about resurgent fascism their actions echo the fascist notion of melding corporate power with the states objectives benito mussolini wanted the state to become the moving center of economic life he successfully coopted italian industrialists to build new infrastructure and the military while stamping out italys historically militant and socialistoriented unions not all big capitalists were devoted fascists but they were careful to maintain what mussolini called formal adherence to the regimeppstrongis there a way to resist authoritarianismstrongppwhether under the control of right or left political regimes or powerful corporations technology allows for the kind of surveillance that would have delighted stalin hitler or maoa greatly enhanced ability to monitor where people go what they buy and what they say to their associates this poses a major barrier to any kind of pushback from the lower classes perhaps as aldous huxley warned in his 1932 novel ema hrefhttpswwwamazoncombravenewworldaldoushuxleydp0060850523brave new worldaem a thoroughly scientific dictatorship will never be overthrownppchina offers the obvious model chinese authorities a hrefhttpsamericanaffairsjournalorg202002thecenturyofchinesecorporatismunderstand thata a conflictualcompetitive system like that usually dominant in america will hold back national economic priorities and damage the social fabricsup supunder the rubric of a hrefhttpswwwwsjcomadarticlechinaenergyresponsibilitycorporate social responsibilitya the state still holds the command keys and although entrepreneurs are allowed to get rich they cannot deviate much from the state orthodoxyppin the west this kind of centralized controlalbeit without the maoist garbis supported by prominent liberals like emnew york timesem journalist a hrefhttpwwwnytimescom20090909opinion09friedmanhtmlthomas friedmana and the former obama budget adviser a hrefhttpswwwtheatlanticcompoliticsarchive201109peterorszagsooverdemocracy337475peter orszaga who believe that climate and other issues are too complex for elected representatives instead some of them recommend ceding power to credentialed experts in washington brussels or genevasup supjerry brown a former governor of california with close ties to a hrefhttpswwwwsjcomarticlesjerrybrownallieswithchinatofightclimatechange11569273903chinas climate effortsa openly favors applying a hrefhttpswwwsacbeecomnewspoliticsgovernmentcapitolalertarticle48466200htmlthe coercive power of the central statea to achieve environmental goals and the a hrefhttpswwwncregistercomblogcaliforniagovtovaticanbrainwashingneededtotackleclimatechangebrainwashinga of the uncomprehending massesppfor much of the upper echelons liberal democracy has become a mere totem cited but not widely backed by corporate executives who were once devotees of free markets and ideas apples tim cook for example a hrefhttpswwwwsjcomarticleschinaschillingsocialcreditblacklist1513036054waxes enthusiastica about a common future in cyberspace with chinas surveillance state wall street a hrefhttpswwwwsjcomarticleschinahasonepowerfulfriendleftintheuswallstreet11606924454actively lobbiesa on behalf of china while oligarchs like michael bloomberg a hrefhttpsnymagcomintelligencer201912michaelbloombergchinapbsclimatexidictatorhtmldescribe chinaa a country of business opportunity for his firm as ecologically friendly democratically accountable and invulnerable to the threat of revolutionsup supfurthering his flattery he has stated that xi jinping is not a dictatorppif liberal ideas are to survive middle and workingclass people will need to advocate against the rising authoritarian state in any of its forms we have not yet reached huxleys embrave new worldem or even the institutionalization of chinas hightech police state the sinews of civic culture still remainchurches independent journals local associations small businessesthat can flex against the imposition of a scientific dictatorship and restore economic opportunity to the vast majorityppbut ideas are not enough liberal democracy must also find ways to restore hope for economic improvement particularly among the young to halt the spread of authoritarianism true liberals must also develop an answer to the economic malaise that spurs its growth and provides its rationale growing class inequities need to be addressed by a new commitment to broadbased economic progressppultimately the survival of liberal civilization depends on citizens who embrace both its freedoms and its obligations activists on both the left and the right have fostered a narrow identity politics that cannot sustain a pluralistic democracy corporate autocracy revolves not around greater opportunities for most but preserving both their selfdefined virtue and their positions of power to fight the growing authoritarian challengeright left and corporatewe must confront the conditions that create it in all three formsp

img altthree paths despotism srchttpss3amazonawscomprodstaticcontentquillettecom202210gettyimages105473538jpgpppdemocracy stake president biden hrefhttpsnewsyahoocombidencitesitalyelectionwarning163245918htmltold gatheringa democratic party governors september 28th warning global spread illiberalism followed stunning gains populist parties hrefhttpswwwnytimescom20220917worldeuropeswedenfarrightelectionhtmlswedena hrefhttpsquillettecom20220928prepareforturbulenceitalya mentioned directly cant sanguine whats happening added biden called domestic opposition hrefhttpswwwnbcnewscompolitics2022electionbidenblastsmagaphilosophysemifascismrcna44953semifascista fears antidemocratic violence remain following storming capitol january 6th 2020 rioters attempting overturn election ppbut worrying developments political right reflect expression new authoritarianism western left advocates free speech tolerant markets embrace massive expansion state power complete expansive curbs expression speech ominous expanded state power intolerance embraced worlds powerful corporations benefited greatly liberalism rule law open inquiryppbeyond west fullbore authoritarians powerxi jinping china vladimir putin russia recep tayyip erdoan turkey end cold war world traveling natural arc democratic future authoritarianism rise hrefhttpswwwnytimescom20161129worldamericaswesternliberaldemocracyhtmltwo decadesa critically chinas rise offers alluringat somemodel new corporate state recalls european fascist regimes 1920s 30s democracies xi said told biden cant sustained 21st centuryppstronghistorical precedence critical preconditionsstrongppautocracys appeal lies partly sense certainty enthusiastic commitment provides 1995 work ema hrefhttpswwwamazoncomnazigermanyhistoryklausfischerdp0760707367nazi germany new historyaem historian klaus fischer argues 20th centurys dictatorial regimes thrived offering version traditional religiosity dogmas priesthood inquisitions preferred emterroirsem societies experiencing economic decline loss traditional social spiritual political moorings 1930s radical cultural changes depressed economic conditions fostered nationalist extremism places rejected constitutional democracy siren song stalinismppwithout depression sense societal unraveling weimar republic unlikely hitler gained power fascism noted historian fl carsten ema hrefhttpswwwamazoncomrisefascismsecondflcarstendp0520046439the rise fascisma em1967 product deep economic social crisis crisis european society todays social turmoil economic decline similar north america hrefhttpswwwftcomcontentafa8440105c641f8b8f62ded251178f8europea face growing threat global economic downturn today 57 percent americans hrefhttpswwwrasmussenreportscompublic_contentbusinessstock_market57_see_depression_aheadaccording rasmussena worry major depression way belief justified offers snapshot growing public anxiety pessimismppthe generational aspect critical pew hrefhttpswwwpewresearchorgglobal20180918expectationsforthefuturehas founda 56 percent residents advanced economies believe children worse unreasonable assumptionin 2018 hrefhttpsthirdwayimgixnetpdfshigheredsbrokenbridgetothemiddleclasspdfhalf recent college gradsa 28000 annually recent study hrefhttpsstradaeducationorgpressreleasepompandcircumstancesnewstudyfindsmostcollegegraduateswhostartoutunderemployedstaytheresuggests thata underemployed graduates remain way permanently frustrations young provide particularly effective kindling extreme politics prewar germany nazis took power notes historian frederic spotts ema hrefhttpswwwamazoncomhitlerpoweraestheticsfredericspottsdp1468316710hitler power aestheticsa em2002 national socialism rage university students hrefhttpswwwdwcomenhitlersoddappealtogermanyoutha16410476young peoplea general disgruntled youngsters filled ranks hrefhttpswwwjstororgstable1431716communist militiasappby contrast support marketcentered institutions free speech tends diminish hard times current economic woes hrefhttpswwwreuterscomarticleusdavosmeetingtrustcapitalismseendoingmoreharmthangoodinglobalsurveyiduskbn1zj0cwedelman surveya reported majority people 28 countries world said believe capitalism harm good fourinfive worry job loss particularly automation rising inequality general fear downward mobility boosted support hrefhttpswwwwsjcomarticlestheeraofbiggovernmentisback11624636813expanded governmenta greater redistribution wealthppfaith democratic model fallen steadily decade disapproval democracy 50 percent globally phenomenon clearly evident hrefhttpswwwtheamericaninterestcom20170701losingnationstatethe united statesa 2020 hrefhttpswwwcamacuksystemfilesreport2020_003pdfglobal survey opiniona cambridgebased center future democracy combined data 48 million respondents43 sources 160 countries 1973 2020found faith democracy falling precipitously generation x millennialsppstrongthe revival populist rightstrongppthe revival populist right represents clearest face resurgent authoritarianism illiberal parties movements reject basic logic economic globalism constitute reaction perceived contempt leading institutions treat national religious family values explicit program hrefhttpswwwtheguardiancomworld2022sep17giorgiamelonibrothersofitalyleaderfarrightelectionsalliancethe brothers italyappsupport rightwing populism obviously driven mass migration fears demagogues slow exploit support mass immigration middle east appeared surge syrian civil war 2015 support liberal border policy soon receded year later pew research hrefhttpswwwpewresearchorgfacttank20160916europeanopinionsoftherefugeecrisisin5chartsfound thata median 50 percent respondents 10 eu countries said immigrants imposing burden country eu country surveyed fourinten having increasing number people different races ethnic groups nationalities makes country better place live 2018 pew hrefhttpswwwpewresearchorgfacttank20181210manyworldwideopposemoremigrationbothintoandoutoftheircountriesfound thata 71 percent italians 58 percent germans 52 percent swedes 41 percent french citizens wanted fewer new immigrants median 10 percent wanted morepfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202210image1png altthree paths despotism width417 height940figurepdespite calls mass immigration europes deepening demographic decline hrefhttpswwwbrusselsreporteu20220201pollrevealsgreatuneaseamongeuropeansaboutmigrationpolicyoverwhelming majoritya virtually european country favors stronger border controls eu frontier opposes arrival large numbers unskilled people immigration dropped pandemic european policies migrants hrefhttpswwwnytimescom20220302magazinegreecemigrationngoshtmlhave tougheneda attitudes hrefhttpswwwdwcomenantiimmigrantattitudesriseworldwidepolla55024481generally hardenedappthe rise crime associated immigration hrefhttpswwwthetimescoukarticleteensroamstreetswithriflesascrimeswampsswedenq83g055k9riled oncesafe swedena suffers hrefhttpswwwwsjcomarticleseuropesrightwardtrendhasreachedswedenelectionvoterscrimeimmigrationmoderatesjimmieakesson11663104023the secondhighesta rate deadly shootings emper capitaem 22 european countries hrefhttpswwwtheatlanticcomnewslettersarchive202208viktororbansracismus671039illiberal nativist politicsa turned hungarys victor orbn celebrated figure populist right europe north america antiimmigrant movements espouse unambiguously racist views inspired opposition kind openended immigration favored prevailing corporate bureaucratic apparatus found inspiration hrefhttpswwweconomistcomdemocracyinamerica20170102thefarrightsnewfascinationwiththemiddleagesin middle agesa example frankish king charles martel defeated muslim invaders eighth centuryppstrongeconomic underpinningsstrongppbut economic dislocation provide populist rights resurgence critical fuel key lie historian eric weitz identifies proletarianization middle class book ema hrefhttpswwwamazoncomweimargermanypromisetragedycentennialdp0691183058weimar germany promise tragedyaem today germany 1930s shopkeepers farmers artisans feel threatened inflation growing power large corporations wall street magnates tech oligarchs 2020 smallbusiness owners america donald trumps hrefhttpswwwtheguardiancombusiness2020feb27smallbusinessownersdonaldtrumpsecondtermstrongest supportersa shop owners europe face potentially disastrous conditionsppincreasingly neoliberalismdefined historian gary gerstle ema hrefhttpswwwamazoncomrisefallneoliberalorderamericadp0197519644the rise fall neoliberal ordera em2022 creed favors free trade free movement capital goods peopleis falling favor large parts western population unlike traditional conservative groups like authoritarians 30s new populist right rejects emlaissezfaireem conservatism generally supports strong welfare state tended anticapitalist collectivist line drive power mussolini radical socialist proffered fascism meeting demands working class canadian historian robert gellately hrefhttpsreasoncom20070815hitlershandoutshas demonstrateda socialist ideas including planned expansion welfare state critical element nazi ideologyppby rejecting neoliberal dogma populist right able appeal workingclass voters hrefhttpstheliberalpatriotsubstackcompthedemocratsworkingclassvoterditching traditional tiesa democrats america hrefhttpswwwopendemocracynetencounteringradicalrighthowfarrighttookovermainstreamto socialdemocratic partiesa europe workingclass shift accelerated adoption draconian green policiesand high energy prices producewhich sparking support rightwing populists particularly hrefhttpsunherdcomthepostafdsupportsurgesineastgermanyeastern reaches germanyappin coming years everstricter environmental controls households businesses surge energy prices reliability shortfalls likely spark kind grassroots rebellions seen hrefhttpswwwbbccomnewsworldeurope50424469emgilets jaunesema protests swept france hrefhttpswwwopendemocracynetencaneuropemakeityellowvestphenomenonandradicalrightreceived sympathetic supporta populist right resent seeing welltodo hrefhttpsnewrepubliccomarticle144199algorescarbonfootprintdoesntmatteradvertize environmental virtuea policies recommend impose extraordinarily high energy housing costs economic sectorsppthere differences todays populist right fascists national socialists 20th century nazis notes historian spotts enjoyed strong support university students intelligentsia todays populists little purchase cognitive elites alienated population served thriving alternative media ecosystem parts hrefhttpswwwmediamattersorgjanuary6insurrectionrightwingmediahavebeendismissingdownplayingandattackingjanuary6have tried turna malcontents january 6th folk heroes martyrs fact stop steal rhetoric adopted hrefhttpswwwpbsorgnewshourpoliticsnearly1in3republicancandidatesforstatewideofficesupportfalseelectionclaimsnearly thirda republican candidates suggests oncegreat party embraced conspiratorial paranoid farright persecution fantasiesppstrongfrom left liberalism authoritarianismstrongpphistorically progressives saw archenemies rightwing authoritarianism great accomplishments liberalismfrom civil rights movement rights women gayscame face stiff opposition reactionary right recent decades left west increasingly authoritarian intolerant dissenting viewsppthis shift occurred progressives grown dominate societys critical institutions academia media sought fortify position tools authoritarianism neartotal dominance cultural heights western societies marked increasing political dogmatism penchant censorship contempt diverge orthodoxies current religion western liberals politics media notes writer hrefhttpstwittercomggreenwaldstatus1567291180974489601glenn greenwalda censorship prime weapon activismppuniversities prime incubators shift bastion open inquiry higher education defined ideological homogeneity particularly hrefhttpspjmediacomnewsandpoliticstoniairaksinen20180809studyprofslesslikelytohirenramembersrepublicansn60081the facultya according hrefhttpswwwnasorgacademicquestions312homogenous_the_political_affiliations_of_elite_liberal_arts_college_facultya recent studya particularly true liberal arts colleges departments entirely republicanfreesup supthe skew especially acute fields affect public policy opinion hrefhttptaxproftypepadcomtaxprof_blog201808byuandpepperdinearethemostideologicallybalancedfacultiesamongthetop50lawschools2013htmlwell 10 percent facultya leading law schools harvard yale stanford columbia berkeleyinstitutions graduate nations leadersdescribe conservativeppsimilarly roughly half british voters lean right 12 percent academics trends common europe hrefhttpsjournalslibraryualbertacacjsindexphpcjsarticleviewfile10363661in canadaa resulting imbalance transformed academia resembling ideological reeducation camp hrefhttpsquillettecom20190618ablackeyeforthecolumbiajournalismreviewprominent schools journalisma moved away teaching fundamentals reporting favor advancing social justice agendasup supeven progressives legal scholar cass sunstein hrefhttpseuamestribcomstoryopinioncolumns20180918casssunsteinproblemwithall10265898007have acknowledgeda students likely good education faculty members likely learn prevailing political orthodoxyppthis kind emde factoem indoctrination combined diminished economic prospects appear driving young people arms populist left france socialist party previously maintained support free speech free markets alliance committed anticapitalism program enlightened social control hrefhttpswwwpoliticoeuarticlejeanlucmelenchonrabblerouserleadernewfranceleftunder leadershipa jeanluc mlenchon admirer late hugo chvez years presidential race 2017 35 hrefhttpswwwbfmtvcompolitiqueelectionspresidentiellepresidentielleles1834ansauraientmisjeanlucmelenchonausecondtour_av202204100362htmlfavored aged trotskyitea populistright standardbearer marine le pen technocratic centrist president emmanuel macronppsimilarly united states democratic socialists america dsa hrefhttpswwwthenationcomarticlepoliticschicagosocialismconferencehave rejecteda liberal elements old left draconian stances capitalism property rights 2016 primaries hrefhttpsreasoncom20220913theauthoritarianconvergencepolicy agendaa socialist bernie sanders included giving close half corporate seats employees expanding federal power aspects economic life hrefhttpswwwwashingtonpostcomnewsthefixwp20160620moreyoungpeoplevotedforberniesandersthantrumpandclintoncombinedbyalotutm_termfba92f8a3fa3easily outpolleda hillary clinton donald trump emcombined emamong under30 voterssup supin 2020 hrefhttpswwwcityjournalorgbidenvictoriesdemocratsleftistfuturevery wella young people older cohorts decisively rejected ppsocialism long anathema america gained currency younger generations poll conducted communism memorial foundation 2016 hrefhttpswwwwashingtontimescomnews2017nov4majoritymillennialswantlivesocialistfascistofound thata 44 percent american millennials favor socialism 14 percent chose fascism communismsup supthe emerging left america enthusiastic supporters censorship apparently perceiving opposition essentially illegitimate caused racism sexism social dysfunction 2018 book ema hrefhttpswwwamazoncompeoplevsdemocracyfreedomdangerdp0674237684the people vs democracy freedom danger save itaem political scientist yascha mounk reveals twothirds older americans embrace democracy hrefhttpswwwtheatlanticcominternationalarchive201803yaschamounkdemocracy554786only oneinthree millennialsa overall white progressives rightwingers constitute hrefhttpswwwtheatlanticcompoliticsarchive201903uscountiesvarytheirdegreepartisanprejudice583072the intolerant groupa america far likely hrefhttpswwwamericansurveycenterorgresearchthestateofamericanfriendshipchangechallengesandlosslosing_a_friend_over_politicsto eschew contactsa political opponents groupppstrongthe corporate authoritariansstrongpparguably potent understood authoritarian drive comes political populists convergence hrefhttpsacademicoupcomrofarticle2346975477414dominant corporationsa bureaucratic establishment increasingly wests economy looks like rule corporate giantismthe giant japanese emzaibatsuem german prewar cartels big family industrial groups mussolinis time tenth economy industries firms dominate twothirds market finance information technology hrefhttpswwweconomistcomgraphicdetail20160324corporateconcentrationppccampaignid17210591673ppcadidgclsrcdsgclsrcdsthe concentrateda europe experienced steady growth corporate concentration decadesppcapitalism increasingly lost competitive character shaped ascendence today giants hrefhttpswwwwsjcomarticlesgooglefacebookagreedtoteamupagainstpossibleantitrustactiondraftlawsuitsays11608612219often colludeasup supeven hrefhttpswwwwsjcomarticlesfacebookmeetsappleinclashofthetechtitansweneedtoinflictpain11613192406fight themselvesalike emdaimyoem medieval japan competition remains comes giants plucky upstarts microsoft controls 90 percent operating system software hrefhttpswwwstatistacomstatistics242549digitaladmarketshareofmajoradsellingcompaniesintheusbyrevenuetextin25202020252c2520google2520accounted2520for252520and2520102520percent252c2520respectivelythree tech firmsa account twothirds online advertizing revenues represent hrefhttpswwwforbescomsitesbradadgate20211208agenciesagree2021wasarecordyearforadspendingwithmoregrowthexpectedin2022sh6d58dbe07bc6the vast majoritya ad sales paragons entrepreneurial vigor firms hrefhttpsamericanaffairsjournalorg202102thepoliticsoftollboothcapitalismhave morpheda exemplars tollbooth capitalism receive revenues transactions far exceed lose failed ventures acquisitionsppfinance markedly hrefhttpswwwclevelandfedorgennewsroomandeventspublicationscommunitydevelopmentbriefsdb20211006hasbankconsolidationchangedpeoplesaccessaspxmore concentrateda number banks 2000 europe experiences slower hrefhttpshomekpmgxxenhomeinsights202102europeanbankingconsolidationhtmlsimilar consolidationa global investing dominated handful companies hrefhttpsfredstlouisfedorgseriesddoi06usa156nwdbfive largesta control 45 percent assets compared 30 percent 20 years ago largest investment banks hrefhttpswwwstatistacomstatistics271008globalmarketshareofinvestmentbankscontrol roughly onethirda investment funds 10 control absolute majority firms hated donald trump partly owed understandable revulsion character hostility china opposition cheap labor provided immigration support efforts break big tech firms united massive contributions electoral efforts remove hrefhttpstimecom5936036secret2020electioncampaignlater celebrateda emtimeem magazineppthe dominant social media players clearly wanted biden white house little trouble covering trumps numerous lies misdeeds censored equally absurd antitrump conspiracies greenwald hrefhttpstheinterceptcom20201015facebookandtwittercrossalinefarmoredangerousthanwhattheycensorpointed outa hrefhttpstaibbisubstackcomptkmashupthemediacampaigntoprotectquashinga emnew york postems hunter biden laptop story hrefhttpsnypostcom20201118bigtechsfreespeechsuppressionisdangerousinformationwarfaredevinetwitter facebooka mention social media ban imposed trump represented remarkable frightening exercise arbitrary power liberals disapprove actsanything reasoned okay helped rid trumpforeign observers actual experience living despotic regimes like german chancellor hrefhttpsnypostcom20210112merkelworldleadersspeakoutagainsttrumpstwitterbanangela merkela russian dissident hrefhttpswwwnbcnewscomnewsworldrussianoppositionleadernavalnyslamstrumpbancensorshipn1253679alexei navalnya impressed like donald trump new italian prime minister viral hrefhttpslegalinsurrectioncom202209youtuberemovesviralvideoofincomingitalianprimeministergiorgiameloniforviolatingtermsofserviceyoutube video removeda supposedly violating platforms community guidelinesppin contrast confrontations trump corporate elite hrefhttpsnypostcom20201128joebidencabinetsettingpresidencyuptobeswampthings2the biden administrationa promised work harmoniously control information emus newsem journalist robert epstein argued googles algorithms hrefhttpswwwusnewscomopinionarticles20160622googleistheworldsbiggestcensoranditspowermustberegulatedthe worlds biggest censora creating jenin younes writing emtabletem magazine hrefhttpswwwtabletmagcomsectionsartslettersarticlesgovernmentprivatizedcensorshipregimehas calleda privatized censorship regime ellie mae ohagan hrefhttpswwwtheguardiancomcommentisfree2018mar18facebookextremistcontentuserdatathe emguardianema exxonmobil attempted insert element lives like concerted grassroots movement curb influenceppin coming years control information shape public attitudes climate emergency mindless dogmatism emwsjems helen raleigh hrefhttpswwwwsjcomarticlesthewestmimicsmaotakesagreenleapforwardcleanenergychinacommunismfarmingindustrializationquota11663767101has compareda maos great leap forward year google hrefhttpsnewsyahoocomgooglecrackdownaffectusercontradicting182500405htmlannounced crackdowna climate policy skepticsincluding wellknown scientistsa policy hrefhttpswwwwsjcomarticlesclimatecensorshipphasetwoginamccarthysocialmediabidenwhitehouse11655156191eagerly embraceda epas director gina mccarthy environmental activist michael shellenberger hrefhttpsmichaelshellenbergersubstackcompwhybidenkeepslyingaboutenergyhas pointed outa theres little appetite found major media outlets challenging hrefhttpsmichaelshellenbergersubstackcompdisinformationbehindcensorshiputm_sourceemailmisleading statementsa bidens energy environmental spokespersons service current white houseppthe corporate authoritarians started use financial power promote preferred policies current craze corporate leaders particularly big investment banks hrefhttpswwwrealclearenergyorgarticles20200827the_folly_of_woke_capitalism_stakeholders_and_the_future_of_american_democracy_575530htmlstakeholder capitalisma means imposition environmental race gender hrefhttpswwwnytimescom20180228opinioncorporateamericaactivismhtmlperquisitesa investments approach hrefhttpswwwomfiforg202103bidenimpactonesginvestingwillgodeeperthanclimatestrong backinga administration time paypal feels free demonetize accounts unacceptable views topics climate change gender fluidity raceppironically powerful media corporate government officials fret resurgent fascism actions echo fascist notion melding corporate power states objectives benito mussolini wanted state moving center economic life successfully coopted italian industrialists build new infrastructure military stamping italys historically militant socialistoriented unions big capitalists devoted fascists careful maintain mussolini called formal adherence regimeppstrongis way resist authoritarianismstrongppwhether control right left political regimes powerful corporations technology allows kind surveillance delighted stalin hitler maoa greatly enhanced ability monitor people buy associates poses major barrier kind pushback lower classes aldous huxley warned 1932 novel ema hrefhttpswwwamazoncombravenewworldaldoushuxleydp0060850523brave new worldaem thoroughly scientific dictatorship overthrownppchina offers obvious model chinese authorities hrefhttpsamericanaffairsjournalorg202002thecenturyofchinesecorporatismunderstand thata conflictualcompetitive system like usually dominant america hold national economic priorities damage social fabricsup supunder rubric hrefhttpswwwwsjcomadarticlechinaenergyresponsibilitycorporate social responsibilitya state holds command keys entrepreneurs allowed rich deviate state orthodoxyppin west kind centralized controlalbeit maoist garbis supported prominent liberals like emnew york timesem journalist hrefhttpwwwnytimescom20090909opinion09friedmanhtmlthomas friedmana obama budget adviser hrefhttpswwwtheatlanticcompoliticsarchive201109peterorszagsooverdemocracy337475peter orszaga believe climate issues complex elected representatives instead recommend ceding power credentialed experts washington brussels genevasup supjerry brown governor california close ties hrefhttpswwwwsjcomarticlesjerrybrownallieswithchinatofightclimatechange11569273903chinas climate effortsa openly favors applying hrefhttpswwwsacbeecomnewspoliticsgovernmentcapitolalertarticle48466200htmlthe coercive power central statea achieve environmental goals hrefhttpswwwncregistercomblogcaliforniagovtovaticanbrainwashingneededtotackleclimatechangebrainwashinga uncomprehending massesppfor upper echelons liberal democracy mere totem cited widely backed corporate executives devotees free markets ideas apples tim cook example hrefhttpswwwwsjcomarticleschinaschillingsocialcreditblacklist1513036054waxes enthusiastica common future cyberspace chinas surveillance state wall street hrefhttpswwwwsjcomarticleschinahasonepowerfulfriendleftintheuswallstreet11606924454actively lobbiesa behalf china oligarchs like michael bloomberg hrefhttpsnymagcomintelligencer201912michaelbloombergchinapbsclimatexidictatorhtmldescribe chinaa country business opportunity firm ecologically friendly democratically accountable invulnerable threat revolutionsup supfurthering flattery stated xi jinping dictatorppif liberal ideas survive middle workingclass people need advocate rising authoritarian state forms reached huxleys embrave new worldem institutionalization chinas hightech police state sinews civic culture remainchurches independent journals local associations small businessesthat flex imposition scientific dictatorship restore economic opportunity vast majorityppbut ideas liberal democracy find ways restore hope economic improvement particularly young halt spread authoritarianism true liberals develop answer economic malaise spurs growth provides rationale growing class inequities need addressed new commitment broadbased economic progressppultimately survival liberal civilization depends citizens embrace freedoms obligations activists left right fostered narrow identity politics sustain pluralistic democracy corporate autocracy revolves greater opportunities preserving selfdefined virtue positions power fight growing authoritarian challengeright left corporatewe confront conditions create formsp

6341faa48095d0e4fa932455

The $2500 fine (read it and weep)

pat first i thought this was twitter bs but no i have been referred to a relnoopener hrefhttpswwwpaypalobjectscommarketinguapdfusenacceptableusefull110322pdf target_blankthe paypal website updateap blockquotepyou may not use the paypal service for activities thatinvolve the sending posting or publication of any messages content or materials that in paypals sole discretion a are harmful obscene harassing or objectionable b depict or appear to depict nudity sexual or other intimate activities c depict or promote illegal drug use d depict or promote violence  criminal activity cruelty or selfharm e depict promote or incite hatred or discrimination of protected groups or of individuals or groups based on protected characteristics eg race religion gender or gender identity sexual orientation etc f present a risk to user safety or wellbeing g are fraudulent promote misinformation or are unlawful h infringe the privacy intellectual property rights or other proprietary rights of any party or i are otherwise unfit for publicationpblockquote pyou cant buy travelers checks with paypal either  for each offense at the discretion of paypal violation of thisbr acceptable use policy constitutes a violation of the paypal user agreement and may subject you to damages including liquidated damages of 250000 us dollars per violation which may be debited directly from your paypal accounts as outlined in the user agreementp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210the2500finereaditandweephtmlthe 2500 fine read it and weepa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pat thought twitter bs referred relnoopener hrefhttpswwwpaypalobjectscommarketinguapdfusenacceptableusefull110322pdf target_blankthe paypal website updateap blockquotepyou use paypal service activities thatinvolve sending posting publication messages content materials paypals sole discretion harmful obscene harassing objectionable b depict appear depict nudity sexual intimate activitiesc depict promote illegal drug use ddepict promoteviolence criminal activity crueltyor selfharme depictpromote incite hatred discrimination protected groups individuals groups based protected characteristics eg race religion gender gender identity sexual orientation etc fpresent risk user safety wellbeing g fraudulent promote misinformation unlawful h infringe privacy intellectual property rights proprietary rights party iare unfit publicationpblockquote pyou cant buy travelers checks paypal offense discretion paypal violation thisbr acceptable use policy constitutes violation paypal user agreement subject damages including liquidated damages 250000 dollars violation debited directly paypal accounts outlined user agreementp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210the2500finereaditandweephtmlthe 2500 fine read weepa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6341fb078095d0e4fa932463

The Invisible Hand Increases Trust, Cooperation, and Universal Moral Action

pmontesquieu a hrefhttppresspubsuchicagoedufoundersdocumentsv1ch4s2htmlfamously noteda thatp blockquotepcommerce is a cure for the most destructive prejudices for it is almost a general rule that wherever we find agreeable manners there commerce flourishes and that wherever there is commerce there we meet with agreeable mannerspblockquote pand a hrefhttpsolllibertyfundorgquotevoltairenotesthatwherecommerceandtolerationpredominateamultiplicityoffaithscanlivetogetherinpeaceandhappiness1764voltaire said of the london stock exchangeap blockquotepgo into the london stock exchange a more respectable place than many a court and you will see representatives from all nations gathered together for the utility of men here jew mohammedan and christian deal with each other as though they were all of the same faith and only apply the word infidel to people who go bankrupt here the presbyterian trusts the anabaptist and the anglican accepts a promise from the quaker on leaving these peaceful and free assemblies some go to the synagogue and others for a drink this one goes to be baptized in a great bath in the name of father son and holy ghost that one has his sons foreskin cut and has some hebrew words he doesnt understand mumbled over the child others go to heir church and await the inspiration of god with their hats on and everybody is happypblockquote pcommerce makes people traders and by and large traders must be benevolent agreeable and willing to bargain and compromise with people of different sects religions and beliefs contrary to what one naively might expect people with more exposure to markets behave emmore cooperativelyem and in a hrefhttpswwwaeaweborgarticlesid101257aer91273less nakedly selfinterested waysa similarly in a letterreturn experiment in italy baldassarri finds that a hrefhttpswwwpnasorgdoi101073pnas1819934117market integration increases prosocial behaviora towards in emandem outgroupsp blockquotepin areas where market exchange is dominant letterreturn rates are high moreover prosocial behavior toward ingroup and outgroup members moves hand in hand thus suggesting that norms of solidarity extend beyond group boundariespblockquote palso contrary to what you may have read about the mythical wall street game versus community game priming people in the lab with phrases evocative of markets and trade a hrefhttpsjournalsplosorgplosonearticleid101371journalpone0055968increases trustap pin a a hrefhttpsacademicoupcomejadvancearticledoi101093ejueac0696712329new papera gustav agneman and esther chevrotbianco test the idea that markets generate more universal behavior they run their tests in villages in greenland where some people buy and sell in markets for their primary living while others in the same village still rely for a substantial part of their subsistence on hunting fishing and personal exchange they use a dice game in which players report the number of a roll with higher numbers being better for the player only the player knows their true roll and there is no way to detect cheaters on an individual basis in some variants other people ingroup or outgroup benefit when players report emlowerem numbers the upshot is that people exposed to market institutions are honest while traditional people cheat cheating is only ameliorated in the traditional group when cheating comes at the expense of an ingroup fellowvillager but not when it comes at the expense of an outgrou member more generally the authors summarizep blockquotepwe conduct rulebreaking experiments in 13 villages across greenland n543 where stark contrasts in market participation within villages allow us to examine the relationship between market participation and moral decisionmaking holding villagelevel factors constant first we document a robust positive association between market participation and moral behaviour towards anonymous others second marketintegrated participants display universalism in moral decisionmaking whereas nonmarket participants make more moral decisions towards covillagers a battery of robustness tests confirms that the behavioural differences between market and nonmarket participants are not driven by socioeconomic variables childhood background cultural identities kinship structure global connectedness and exposure to religious and political institutionspblockquote pmarkets and trade increase trust cooperation and universal moral actionit is hard to think of a more important finding for the world todayp phat tip the still excellent kevin lewisp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210theinvisiblehandincreasestrustcooperationanduniversalmoralactionhtmlthe invisible hand increases trust cooperation and universal moral actiona appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pmontesquieua hrefhttppresspubsuchicagoedufoundersdocumentsv1ch4s2htmlfamously notedathatp blockquotepcommerce cure destructive prejudices general rule find agreeable manners commerce flourishes commerce meet agreeable mannerspblockquote pand hrefhttpsolllibertyfundorgquotevoltairenotesthatwherecommerceandtolerationpredominateamultiplicityoffaithscanlivetogetherinpeaceandhappiness1764voltaire said london stock exchangeap blockquotepgo london stock exchange respectable place court representatives nations gathered utility men jew mohammedan christian deal faith apply word infidel people bankrupt presbyterian trusts anabaptist anglican accepts promise quaker leaving peaceful free assemblies synagogue drink goes baptized great bath father son holy ghost sons foreskin cut hebrew words doesnt understand mumbled child heir church await inspiration god hats everybody happypblockquote pcommerce makes people traders large traders benevolent agreeable willing bargain compromise people different sects religions beliefs contrary naively expect people exposure markets behave emmore cooperativelyem hrefhttpswwwaeaweborgarticlesid101257aer91273less nakedly selfinterested waysa similarly letterreturn experiment italy baldassarri finds hrefhttpswwwpnasorgdoi101073pnas1819934117market integration increases prosocial behaviora emandem outgroupsp blockquotepin areas market exchange dominant letterreturn rates high prosocial behavior ingroup outgroup members moves hand hand suggesting norms solidarity extend group boundariespblockquote palso contrary read mythical wall street game versus community game priming people lab phrases evocative markets trade hrefhttpsjournalsplosorgplosonearticleid101371journalpone0055968increases trustap pin hrefhttpsacademicoupcomejadvancearticledoi101093ejueac0696712329new papera gustav agneman esther chevrotbianco test idea markets generate universal behavior run tests villages greenland people buy sell markets primary living village rely substantial subsistence hunting fishing personal exchange use dice game players report number roll higher numbers better player player knows true roll way detect cheaters individual basis variants people ingroup outgroup benefit players report emlowerem numbers upshot people exposed market institutions honest traditional people cheat cheating ameliorated traditional group cheating comes expense ingroup fellowvillager comes expense outgrou member generally authors summarizep blockquotepwe conduct rulebreaking experiments 13 villages greenland n543 stark contrasts market participation villages allow examine relationship market participation moral decisionmaking holding villagelevel factors constant document robust positive association market participation moral behaviour anonymous second marketintegrated participants display universalism moral decisionmaking nonmarket participants moral decisions covillagers battery robustness tests confirms behavioural differences market nonmarket participants driven socioeconomic variables childhood background cultural identities kinship structure global connectedness exposure religious political institutionspblockquote pmarkets trade increase trust cooperation universal moral actionit hard think important finding world todayp phat tip excellent kevin lewisp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210theinvisiblehandincreasestrustcooperationanduniversalmoralactionhtmlthe invisible hand increases trust cooperation universal moral actiona appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6341fb688095d0e4fa932478

Inflation and attention

blockquotepone of the dangers of high inflation is that it can cause firms and households to pay close attention to it this internalization of inflation can lead to an accelerationist regime making inflation harder to control we empirically assess the relationship between attention and the level of inflation for 37 countries our measures of attention are constructed either from internet search behavior or the popularity of inflation mentions on twitter we find evidence that attention thresholds do exist for the majority of countries in our sample we also find interesting variability across countriespblockquote phere is a relnoopener hrefhttpspapersssrncomsol3paperscfmabstract_id4230600 target_blankthe full papera by oleg korenok david munro and jiayi chen via john chiltonp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210inflationandattentionhtmlinflation and attentiona appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

blockquotepone dangers high inflation cause firms households pay close attention internalization inflation lead accelerationist regime making inflation harder control empirically assess relationship attention level inflation 37 countries measures attention constructed internet search behavior popularity inflation mentions twitter find evidence attention thresholds exist majority countries sample find interesting variability countriespblockquote phere relnoopener hrefhttpspapersssrncomsol3paperscfmabstract_id4230600 target_blankthe papera oleg korenok david munro jiayi chen john chiltonp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210inflationandattentionhtmlinflation attentiona appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

63434c6ea2fb18b0ef59aaac

That was then, this is now

pa relnoopener hrefhttpspublicpolicypaypalcorpcomnewsinternetassociationrelaunchesnetneutralitydayaction target_blankfrom 2018ap blockquotepon may 9 paypal is participating in the net neutrality day of action through its trade association internet association to support a free and open internetthroughout the day of may 9 ia and all of its member companies will communicate their support for enforceable principles such as a ban on blocking throttling and paid prioritizationthose lack of choices can lead to internet service providers isps playing gatekeeper to content and accesspblockquote pnet neutrality for thee but not for mep pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210thatwasthenthisisnow39htmlthat was then this is nowa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pa relnoopener hrefhttpspublicpolicypaypalcorpcomnewsinternetassociationrelaunchesnetneutralitydayaction target_blankfrom 2018ap blockquotepon 9 paypal participating net neutrality day action trade association internet association support free open internetthroughout day 9 ia member companies communicate support enforceable principles ban blocking throttling paid prioritizationthose lack choices lead internet service providers isps playing gatekeeper content accesspblockquote pnet neutrality thee mep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210thatwasthenthisisnow39htmlthat nowa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

63434cd9a2fb18b0ef59aabe

An Effective Altruism mutual fund?

pa few days ago i a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202210butareyoulongvolatilityhtml target_blankargueda that believers in agi should be long volatility in asset markets  whether or not you agree with that exact prescription why isnt there an ea mutual fund reflecting ea views of the world whatever those may be  maybe the fund would instead load up on semiconductor chips in any case they could aggregate the debates from all those ea forums to make the better decisionsp ppresumably eaers are morally obliged to set up such a fund  i dont mean that as sarcasm maybe it really would be a good idea  ea supporters then could invest in the fund and would over time have more resources to invest in other causes  the fund also could reflect their moral priorities such as not investing in factory farms i dont think any real net loss of diversificatory power would be involved in such a decisionp palternatively you might argue that ea has only emmoralem insight and no predictive superiority about what will happen at larger levels  that too is a plausible view especially among noneaersp pbut it seems to me one of these should be true either that there should be an ea mutual fund or that ea has only moral insight not predictive insight  which is it going to bep pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210aneffectivealtruismmutualfundhtmlan effective altruism mutual funda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pa days ago relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202210butareyoulongvolatilityhtml target_blankargueda believers agi long volatility asset markets agree exact prescription isnt ea mutual fund reflecting ea views world maybe fund instead load semiconductor chips case aggregate debates ea forums better decisionsp ppresumably eaers morally obliged set fund dont mean sarcasm maybe good idea ea supporters invest fund time resources invest causes fund reflect moral priorities investing factory farms dont think real net loss diversificatory power involved decisionp palternatively argue ea emmoralem insight predictive superiority happen larger levels plausible view especially noneaersp pbut true ea mutual fund ea moral insight predictive insight going bep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210aneffectivealtruismmutualfundhtmlan effective altruism mutual funda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

63434cdfa2fb18b0ef59aac0

*In Search of Monsters to Destroy*

pthe author is my colleague christopher j coyne and the subtitle is emthe folly of the american empire and the paths to peaceem  chris is a noninterventionist in foreign policy and i am not but if you wish to read the best arguments for that positionthis is your bookp pimg sizesmaxwidth 200px 100vw 200px srchttpmarginalrevolutioncomwpcontentuploads202210zcoyne200x300jpg alt width200 srcsethttpmarginalrevolutioncomwpcontentuploads202210zcoyne200x300jpg 200w httpmarginalrevolutioncomwpcontentuploads202210zcoynejpg 666w classwpimage84467 height300p pyou can preorder a relnoopener hrefhttpswwwamazoncomsearchmonstersdestroyamericanempiredp1598133470refsr_1_1crid2q4k6ibrj3045keywordsinsearchofmonsterstodestroychristophercoyneqid1665258652sprefixinsearchofmonsters2caps2c954sr81 target_blankhereap pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210insearchofmonsterstodestroyhtmlin search of monsters to destroya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pthe author colleague christopher j coyne subtitle emthe folly american empire paths peaceem chris noninterventionist foreign policy wish read best arguments positionthis bookp pimg sizesmaxwidth 200px 100vw 200px srchttpmarginalrevolutioncomwpcontentuploads202210zcoyne200x300jpg alt width200 srcsethttpmarginalrevolutioncomwpcontentuploads202210zcoyne200x300jpg 200w httpmarginalrevolutioncomwpcontentuploads202210zcoynejpg 666w classwpimage84467 height300p pyou preorder relnoopener hrefhttpswwwamazoncomsearchmonstersdestroyamericanempiredp1598133470refsr_1_1crid2q4k6ibrj3045keywordsinsearchofmonsterstodestroychristophercoyneqid1665258652sprefixinsearchofmonsters2caps2c954sr81 target_blankhereap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210insearchofmonsterstodestroyhtmlin search monsters destroya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

63449d5cbbfa3cbde0a21afe

Can We Deter Russia From Using Nukes?

img altcan we deter russia from using nukes srchttpswisdomofcrowdslivecontentimages202210ships_in_distress_off_a_rocky_coast_19852911jpgpi woke up this morning in zagreb to news that several ukrainian cities including kyiv were under attack russia had launched a set of cruise missiles and drones many targeted at civilians on their morning commutes and at children heading to school russian media seemed to be indicating that this was intended as a response to an unattributed attack over the weekend that damaged the new bridge over the kerch strait linking occupied crimea to the russian mainland the bridge represents a vital supply link for russias faltering war machine with the attack possibly threatening all the territory it has occupied since 2014ppukraine was officially silent about the kerch incident though there was much jubilation on social media by its wellcoordinated army of internet activists the attack came days after the emnew york timesem a hrefhttpswwwnytimescom20221005uspoliticsukrainerussiaduginaassassinationhtmlreporteda a leak from us intelligence suggesting a moscow car bombing in august that killed the daughter of a leading russian nationalist ideologue was the work of ukrainian spiesppthis is all unfolding as the war in ukraine has ratcheted up tensions between nuclear armed powers to levels arguably unimaginable even at the height of the cold war ukraines ground forces have seen spectacular gains on the ground against overstretched and underequipped russian forces strung out across the frontlines this in turn has forced russian president vladimir putin to both start a partial mobilization across russia and to unambiguously threaten the use of nuclear weapons should ukraine not sue for peaceppthe attacks on kyiv this morning were clearly in response to the kerch operation johns hopkins universitys dr sergey radchenko a hrefhttpstwittercomdrradchenkostatus1579366408613687296s61tnik7ugjwaf3p5mycnc7cmqargueda on twitteran attempt by putin to solidify his position at home and show those in his administration baying for blood that he is as ruthless as they are but the attacks were more than just that he went onpblockquoteemfinally and this is probably the key motivation this strike aims to demonstrate capability if not the intent to obliterate kyiv because of course theres an implied nuclear threat behind each conventional strike into the heart of the ukrainian capital putin is basically saying here that he cannot be outplayed in the game of oneupmanship simply because he suffers from no moral restraints its a serious message and its not clear yet what our response to this will beemblockquotepradchenko gets to the heart of the matter what is to be done where do we go now for guidance i warmly recommend two articles by two of my former colleagues and friends one laying out a more aggressive path forward for us policy and one arguing for staying the courseppwalter russell meads a hrefhttpswwwwsjcomarticleswouldwerisknewyorktokeepodessafreeputinbidentacticalnukeblackmaildeterrencenatodiplomacy11665068559columna last wednesday in the emwall street journal emtightly lays out how the biden administrations policies have gotten us to where we are i have at times conceded that biden played the runup to the invasion well eschewing escalatory rhetoric as russian forces massed on the border in doing so it has seemed to me biden built up solidarity across europe and drew a line at natos borders that has thus far firmly held had biden pursued the policy i favored in january and februaryof massing us troops on natos borders including potentially putting nuclear weapons in romania and threatening unspecified repercussions should putin invadeits quite likely that the fickle europeans would have split from us had putin invaded anyway many europeans would have blamed the united states for triggering the war instead we now have the west more or less standing firm with russia badly bloodied and increasingly isolated from even its erstwhile ally china and ukraine pressing its advantage on the groundppthats precisely backwards walter argues biden has set ukraine and by extension the west up for a loss by drawing a thick line between nato and ukraine putin was implicitly told that he had ultimate escalatory dominance in the actual theater of war at the limit russia has nukes ukraine does not and we clearly signaled that we would not get directly involved in the war beyond arming and tactically supporting ukrainian efforts on the ground as we approach that limit the logic is predictably playing out ppas walter a hrefhttpswwwwsjcomarticlesputinsnuclearthreatisrealannexationkremlinwestimperialismbidenukraineworldorderretreatconcessionsblackmail11664824197argued in an earlier columna anything short of russia being seen to lose the current war which would include some kind of armistice that solidifies russias hold on territory beyond the 2014 lines must be judged a win for armed territorial revisionism this will prove a massive blow to american credibility and power overseas even a partial pyrrhic victory by russia would set a precedent emboldening the likes of china and iran and dispiriting allies like taiwan south korea and japan drawing too firm a line at natos borders in the ukraine war will have circumscribed american power more broadlyppjason willick a hrefhttpswwwwashingtonpostcomopinions20221006putinnuclearbidenavoidwarwritinga in the emwashington postem casts a different light on the current situation and more clearly channels the biden administrations case this is exactly what victory looks like jason argues putin stands alone his army is wrecked his economy is battered and no matter how the war ends russia will likely be a permanently diminished power in the world the united states has deftly managed to lay low one of its rivals by creating an efficient meat grinder on its borders at manageable financial cost to itself and with zero american lives lostppstay the course jason counsels keep arming the ukrainians but do no more the biden administrations policy has always been to let the ukrainians win back as much territory as they can at the cost of emonly emtheir own lives this is what the oftrepeated mantra of we will not dictate to ukraine the terms of peace means in practice at the limit it suggests that its up to the ukrainians to modulate the risks of triggering nuclear reprisals from russia muddying the waters now by trying to deter nuclear aggression by explicitly threatening direct involvement would only embolden ukraine to gamble more boldly making a civilizationending conflict all the more likely holding the current policy line forces the ukrainians to more clearly face the choices before them and indeed a nuclear attack on ukraine may not be enough to halt its resistance if kyiv decides to push through after nukes are deployed against its forces or its cities we must continue supporting them all the while maintaining the ultimate red line at natos borders pdiv dataplaceholdersubscribedivpin this perspective the endgame is clear no matter where the final lines are drawn nato is united as never before ukraine becomes a permanent garrisonbuffer zone in europe and russia remains a failure and a nuclear pariah normalization with russia under putin or any leader ideologically similar to him is already out of the question nuclear first use will only further marginalize prorussian voices in europe and perhaps more broadly in the world welcome to the 21st centuryppregular readers will know that i am quite sympathetic to jasons framing but i dont want to somehow suggest that walters points are easy to dismiss quite to the contrary i cant get them out of my head ppthe detonation of a nuclear weapon in anger would almost certainly scramble the world order no matter what the final territorial outcome on the other side of it trying to avert such an event should preoccupy us at this moment and walters proposal is a serious one biden must undo the mistakes that led us to the current situation he must abandon his approach of shepherding the west to consensus and instead start to lead more forthrightlyppfirst biden must decide for himself that an eyeballtoeyeball confrontation with russia is firmly in our interest any internal wavering will undermine next steps having done so he must start building an actual war coalition with all that implies rather than playing down the danger he needs to dramatize it walter writes the theatricsemergency nato summits addresses to congress prime time speeches to the american peopleneed to convince moscow that any nuclear attack on ukraine will bring devastating consequences for russia ppthe nuclear saber should perhaps remain sheathed but only ambiguously so ambiguity ramps up uncertainty ukraine wielding western weapons has already shown russians just how badly outmatched they are against nato tech and kyiv has achieved everything it has with no meaningful air or naval support it could only get worse for russian troops if the west were to really lean in loud threats should of course be accompanied by quiet diplomacy walter avers with off ramps for russia at the ready but the final outcome must be unambiguous russia will have to visibly stand downppbut how credible would these threats be the american president has an enormous bully pulpit and his word has to be taken seriously around the globe by dint of americas overwhelming might alone every pronouncement of even an erratic leader like president donald trump who had uncertain control over his own administration kept foreign capitals rapt joe biden is an old cold warrior and he certainly should know how to play the deterrence game if he decides to do so his words carry profound weightppand russia already badly bruised would have to do some hard calculations of its own what percentages does it assign to biden being able to follow through what percentage is it comfortable with what does its future look like if its entire army is obliterated in ukraine the disastrous 1990s as civil wars raged in farflung provinces while moscow helplessly watched from the center is a formative memory of putins generation of strongmen this time would almost certainly be worseppthe weakest point in this more aggressive approach however is found in the title of walters own column perhaps not written by him the question on putins mind would we risk new york to keep odessa free this is what leaves me hesitant above all else building a real war coalition will be extraordinarily difficult abroad even more so than at home one might be able to fudge the existential question in washington with stern speeches but i seriously doubt that europeans would easily fall into line putting their own capitals at risk for ukraine ppviktor orbans hungary has for months argued that ukraines war is not our own complaining that europeans are paying the price for inscrutable slav bloodletting a certain soft russophilia a hrefhttpsbalkaninsightcom20221007bulgariaspoliticianswaverbetweenatlanticcoalitionandendlesselectionsremainsa a potent political force in bulgaria and a a hrefhttpswwweuractivcomsectionpoliticsshort_newsmostslovakswantrussiatowinukrainewarrecent polla found that a majority of slovaks were rooting for russia to win but none of those countries really swing the balance in any meaningful way germany however is a country of a different caliber its heretofore hesitant halting approach to supporting ukraine is a symptom of deeper forces at play chancellor olaf scholz and foreign minister annalena baerbock understand the stakes but are also keenly aware of just what their country will bear an even bigger europeanwide a hrefhttpsnewsyahoocomnatoleaderukrainefasttrack205847143htmltella was how quickly and curtly ukrainian president volodomyr zelenskys plea for ukraine to be fasttracked into nato was rejected last week the hesitancy extends well beyond berlinppif putin is not a halfwit he knows all this europeans might well empathize with ukraines plight and might even be willing to suffer some hardships in the coming winters as a result of too tightly coupling their economies to the russian energy dynamo but risk berlin or paris or amsterdam for kyiv i doubt it the right approach for russia therefore would be for putin to continue threatening nuclear armageddon while waiting for the european coalition to fragment as biden barksppso much of this feels like the cold war including the part where the soviet union tries to crack the western alliance along its german fault line with nukes and the broader stakes that walter lays out are similarlydepressinglyfamiliar my dilemma is that i worry the old cold war playbook might not work this time given the nature of the weakkneed coalition that the united states finds itself leading this may feel like the cold war but i dont sense that this is a cold war europe at the end of the day this war is economically damaging and morally offensive to most europeans but it is definitely not existential like the cold war was it can only become so if the united states pulls europe in to directly participating in the fight they will resist mightily and publiclyppthat said how much does that matter perhaps the europeans could be brought onside with stirring rhetoric or at least put into an uncomfortable corner after all their options are limited what could they do in protest western unity matters but it is not an end unto itself as many in the biden white house seem to believe indeed washington could credibly stare down moscows nuclear threat without europe firmly by its side in doing so it will have to contend with bickering allies and an empowered peace lobby across the continent demanding ukraine make unreasonable concessions it will have to invest more and more of its scarce resources in managing bruised egosppon second thought maybe it emis emjust like cold war europe after allp

img altcan deter russia nukes srchttpswisdomofcrowdslivecontentimages202210ships_in_distress_off_a_rocky_coast_19852911jpgpi woke morning zagreb news ukrainian cities including kyiv attack russia launched set cruise missiles drones targeted civilians morning commutes children heading school russian media indicating intended response unattributed attack weekend damaged new bridge kerch strait linking occupied crimea russian mainland bridge represents vital supply link russias faltering war machine attack possibly threatening territory occupied 2014ppukraine officially silent kerch incident jubilation social media wellcoordinated army internet activists attack came days emnew york timesem hrefhttpswwwnytimescom20221005uspoliticsukrainerussiaduginaassassinationhtmlreporteda leak intelligence suggesting moscow car bombing august killed daughter leading russian nationalist ideologue work ukrainian spiesppthis unfolding war ukraine ratcheted tensions nuclear armed powers levels arguably unimaginable height cold war ukraines ground forces seen spectacular gains ground overstretched underequipped russian forces strung frontlines turn forced russian president vladimir putin start partial mobilization russia unambiguously threaten use nuclear weapons ukraine sue peaceppthe attacks kyiv morning clearly response kerch operation johns hopkins universitys dr sergey radchenko hrefhttpstwittercomdrradchenkostatus1579366408613687296s61tnik7ugjwaf3p5mycnc7cmqargueda twitteran attempt putin solidify position home administration baying blood ruthless attacks went onpblockquoteemfinally probably key motivation strike aims demonstrate capability intent obliterate kyiv course theres implied nuclear threat conventional strike heart ukrainian capital putin basically saying outplayed game oneupmanship simply suffers moral restraints message clear response beemblockquotepradchenko gets heart matter guidance warmly recommend articles colleagues friends laying aggressive path forward policy arguing staying courseppwalter russell meads hrefhttpswwwwsjcomarticleswouldwerisknewyorktokeepodessafreeputinbidentacticalnukeblackmaildeterrencenatodiplomacy11665068559columna wednesday emwall street journal emtightly lays biden administrations policies gotten times conceded biden played runup invasion eschewing escalatory rhetoric russian forces massed border biden built solidarity europe drew line natos borders far firmly held biden pursued policy favored january februaryof massing troops natos borders including potentially putting nuclear weapons romania threatening unspecified repercussions putin invadeits likely fickle europeans split putin invaded europeans blamed united states triggering war instead west standing firm russia badly bloodied increasingly isolated erstwhile ally china ukraine pressing advantage groundppthats precisely backwards walter argues biden set ukraine extension west loss drawing thick line nato ukraine putin implicitly told ultimate escalatory dominance actual theater war limit russia nukes ukraine clearly signaled directly involved war arming tactically supporting ukrainian efforts ground approach limit logic predictably playing ppas walter hrefhttpswwwwsjcomarticlesputinsnuclearthreatisrealannexationkremlinwestimperialismbidenukraineworldorderretreatconcessionsblackmail11664824197argued earlier columna short russia seen lose current war include kind armistice solidifies russias hold territory 2014 lines judged win armed territorial revisionism prove massive blow american credibility power overseas partial pyrrhic victory russia set precedent emboldening likes china iran dispiriting allies like taiwan south korea japan drawing firm line natos borders ukraine war circumscribed american power broadlyppjason willick hrefhttpswwwwashingtonpostcomopinions20221006putinnuclearbidenavoidwarwritinga emwashington postem casts different light current situation clearly channels biden administrations case exactly victory looks like jason argues putin stands army wrecked economy battered matter war ends russia likely permanently diminished power world united states deftly managed lay low rivals creating efficient meat grinder borders manageable financial cost zero american lives lostppstay course jason counsels arming ukrainians biden administrations policy let ukrainians win territory cost emonly emtheir lives oftrepeated mantra dictate ukraine terms peace means practice limit suggests ukrainians modulate risks triggering nuclear reprisals russia muddying waters trying deter nuclear aggression explicitly threatening direct involvement embolden ukraine gamble boldly making civilizationending conflict likely holding current policy line forces ukrainians clearly face choices nuclear attack ukraine halt resistance kyiv decides push nukes deployed forces cities continue supporting maintaining ultimate red line natos borders pdiv dataplaceholdersubscribedivpin perspective endgame clear matter final lines drawn nato united ukraine permanent garrisonbuffer zone europe russia remains failure nuclear pariah normalization russia putin leader ideologically similar question nuclear use marginalize prorussian voices europe broadly world welcome 21st centuryppregular readers know sympathetic jasons framing dont want suggest walters points easy dismiss contrary cant head ppthe detonation nuclear weapon anger certainly scramble world order matter final territorial outcome trying avert event preoccupy moment walters proposal biden undo mistakes led current situation abandon approach shepherding west consensus instead start lead forthrightlyppfirst biden decide eyeballtoeyeball confrontation russia firmly interest internal wavering undermine steps having start building actual war coalition implies playing danger needs dramatize walter writes theatricsemergency nato summits addresses congress prime time speeches american peopleneed convince moscow nuclear attack ukraine bring devastating consequences russia ppthe nuclear saber remain sheathed ambiguously ambiguity ramps uncertainty ukraine wielding western weapons shown russians badly outmatched nato tech kyiv achieved meaningful air naval support worse russian troops west lean loud threats course accompanied quiet diplomacy walter avers ramps russia ready final outcome unambiguous russia visibly stand downppbut credible threats american president enormous bully pulpit word taken seriously globe dint americas overwhelming pronouncement erratic leader like president donald trump uncertain control administration kept foreign capitals rapt joe biden old cold warrior certainly know play deterrence game decides words carry profound weightppand russia badly bruised hard calculations percentages assign biden able follow percentage comfortable future look like entire army obliterated ukraine disastrous 1990s civil wars raged farflung provinces moscow helplessly watched center formative memory putins generation strongmen time certainly worseppthe weakest point aggressive approach found title walters column written question putins mind risk new york odessa free leaves hesitant building real war coalition extraordinarily difficult abroad home able fudge existential question washington stern speeches seriously doubt europeans easily fall line putting capitals risk ukraine ppviktor orbans hungary months argued ukraines war complaining europeans paying price inscrutable slav bloodletting certain soft russophilia hrefhttpsbalkaninsightcom20221007bulgariaspoliticianswaverbetweenatlanticcoalitionandendlesselectionsremainsa potent political force bulgaria hrefhttpswwweuractivcomsectionpoliticsshort_newsmostslovakswantrussiatowinukrainewarrecent polla found majority slovaks rooting russia win countries swing balance meaningful way germany country different caliber heretofore hesitant halting approach supporting ukraine symptom deeper forces play chancellor olaf scholz foreign minister annalena baerbock understand stakes keenly aware country bear bigger europeanwide hrefhttpsnewsyahoocomnatoleaderukrainefasttrack205847143htmltella quickly curtly ukrainian president volodomyr zelenskys plea ukraine fasttracked nato rejected week hesitancy extends berlinppif putin halfwit knows europeans empathize ukraines plight willing suffer hardships coming winters result tightly coupling economies russian energy dynamo risk berlin paris amsterdam kyiv doubt right approach russia putin continue threatening nuclear armageddon waiting european coalition fragment biden barksppso feels like cold war including soviet union tries crack western alliance german fault line nukes broader stakes walter lays similarlydepressinglyfamiliar dilemma worry old cold war playbook work time given nature weakkneed coalition united states finds leading feel like cold war dont sense cold war europe end day war economically damaging morally offensive europeans definitely existential like cold war united states pulls europe directly participating fight resist mightily publiclyppthat said matter europeans brought onside stirring rhetoric uncomfortable corner options limited protest western unity matters end unto biden white house believe washington credibly stare moscows nuclear threat europe firmly contend bickering allies empowered peace lobby continent demanding ukraine unreasonable concessions invest scarce resources managing bruised egosppon second thought maybe emis emjust like cold war europe allp

63449d5fbbfa3cbde0a21b00

Biden Says He's Pardoning 'All' Federal Weed Possession Offenders. He Isn't.

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210cannabisjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210cannabis1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210cannabis600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210cannabis331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210cannabisjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210cannabis1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210cannabis600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210cannabis331x186jpg 331w img width1200 altpresident joe biden is pictured against a background of marijuana plants srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpg height675 picture div pspanpresident joe biden spana hrefhttpstwittercompotusstatus1578097878094024712spanannouncedspanaspan thursday that he is quotpardoning all prior federal offenses of simple marijuana possessionquot this is a welspanspancome move but a modest one since it provides relief to only a spana hrefhttpsreasoncom20221006bidensmarijuanareformsarelongoverduebutwillhavejustamodestimpactspansmall sharespanaspan of us citizens with federal marijuana recordsspanspan and despite that declaration that hes pardoning quotallquot offenders spanspanthe pardons language spana hrefhttpswwwwhitehousegovbriefingroompresidentialactions20221006grantingpardonfortheoffenseofsimplepossessionofmarijuanaspanspecifiesspanaspan that only quotcurrent united states citizens and lawful permanent residentsquot are eligible for reliefspanp paccording to david bier associate director of immigration studies at the cato institute someone wouldnt be eligible for a pardon if they committed an offense while unlawfully present in the country quoteven if you subsequently received a green card or us citizenshipquot the pardons language even excludes people such as tourists who are here lawfully but are not permanent residentsp pspannoncitizens comprise a significant share of people with federal marijuana possession records from 20152021 the us sentencing commission ussc spanspana hrefhttpsreasoncomwpcontentuploads202210federaloffendersineachdistrict1pdfrecordeda 6276 federal offenders with marijuana possession charges of those it a hrefhttpsreasoncomwpcontentuploads202210federaloffendersineachdistrict2pdflisteda 4341roughly 70 percentas noncitizen offenders nearly all of them were reported in districts along the usmexico border the number of noncitizen marijuana possession offenders has a hrefhttpsidausscgovanalyticssawdlldashboardusscaskidacustompopupclosedroppeda from 1670 in fy 2015 to just six in fy 2021spanp pspana ussc report covering fy 2013 spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanfoundspanaspan that 943 percent of border offenders were noncitizens while 165 percent of nonborder offenders were quotnearly allquot marijuana simple possession offenders apprehended at the border that year quothad little or no prior criminal historyquot they were carrying a median weight of 485 pounds of marijuana which the ussc a hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfsaysa quotdoes not appear to correspond to simple possessionquotspanp pspanrather those may have been the spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanresultspanaspan of quotmarijuana drug trafficking cases in which the offender was sentenced only for a possession offensequot the ussc reports nearly 98 percent of simple possession offenders at the border in fiscal year 2013 spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanreceivedspanaspan prison time with a median sentence of six months while 264 percent of nonborder offenders got jail time that same year per a 2016 a hrefhttpsdrugpolicyorgsitesdefaultfilesdpa20fact20sheet_the20drug20war20and20mass20deportation_28feb20201629pdfreporta from the drug policy alliance dpa less than 1 percent of those deported were drug traffickersspanp pby contrast the dpa notes simple marijuana possession was quotthe most common cause of deportation for drug law violationsquot in 2013 failing to pardon people who arent citizens or lawful permanent residents keeps them at risk of removal quota pardon wipes out the grounds of deportability for a noncitizenquot says bier so noncitizens without quotlegal permanent resident status eg refugees asylees etc would still be deportable based solely on a marijuana convictionquotp pspanthats true of noncitizens with state and federal marijuana records according to the transactional records access clearinghouse a syracuse university organization that analyzes immigration data over 45000 people were spana hrefhttpswwwboundlesscomblogbidenmarijuanapardonimmigrationtextfor20now2c20cannabis20possession20is20a20deportable20offenseamptextfrom20200320to20august202018trac20at20syracuse20universityspandeportedspanaspan for marijuana possession from fy 2003 to august 2018 noncitizens who have consumed sold or possessed marijuana may be spana hrefhttpswwwboundlesscomblogbidenmarijuanapardonimmigrationspanbarredspanaspan from entering the us or receive denials on their citizenship applicationsspanp pspaneven as statesand now the biden administrationhave relaxed their stances toward marijuana use someones immigration status can lead to spana hrefhttpswwwthemarshallprojectorg20150616getcaughtwithpotfacedeportationspandrastic punishmentsspanaspan for drug convictions though bidens marijuana announcement spana hrefhttpstwittercompotusstatus1578097880744820736spancalledspanaspan for a review of how marijuana is classified under federal law he issued no such request that government bodies review the immigration and nationality act to spana hrefhttpswwwcongressgovbill117thcongresshousebill1614textspanremovespanaspan marijuana use possession and distribution as grounds for a migrants inadmissibility even if biden had extended his pardon to noncitizens bier explains that immigrants would quotstill be subject to the controlled substance grounds of inadmissibilityquotspanp pspanbiden rightly spana hrefhttpsreasoncom20221006bidensmarijuanareformsarelongoverduebutwillhavejustamodestimpactspannotesspanaspan that marijuana relief will help people quotwho may be denied employment housing or educational opportunitiesquot by virtue of their drug convictions that line of reasoning applies just as much to noncitizens as it does to citizensspanp pspanquotthere is no good reason to exclude any noncitizen from this orderquot says bier quotthe president lays out all the reasons why americans have come to believe that marijuana [possession] convictions lack legitimacy and impose unnecessary harms yet he still wants to apply those penalties and others to noncitizens as well as to us citizens and green card holders who were once here illegallyquotspanp pthe post a relnofollow hrefhttpsreasoncom20221010bidensayshespardoningallfederalweedpossessionoffendersheisntbiden says hes pardoning all federal weed possession offenders he isnta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210cannabisjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210cannabis1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210cannabis600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210cannabis331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210cannabisjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210cannabis1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210cannabis600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210cannabis331x186jpg 331w img width1200 altpresident joe biden pictured background marijuana plants srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210cannabis800x450jpg height675 picture div pspanpresident joe biden spana hrefhttpstwittercompotusstatus1578097878094024712spanannouncedspanaspan thursday quotpardoning prior federal offenses simple marijuana possessionquot welspanspancome modest provides relief spana hrefhttpsreasoncom20221006bidensmarijuanareformsarelongoverduebutwillhavejustamodestimpactspansmall sharespanaspan citizens federal marijuana recordsspanspan despite declaration hes pardoning quotallquot offenders spanspanthe pardons language spana hrefhttpswwwwhitehousegovbriefingroompresidentialactions20221006grantingpardonfortheoffenseofsimplepossessionofmarijuanaspanspecifiesspanaspan quotcurrent united states citizens lawful permanent residentsquot eligible reliefspanp paccording david bier associate director immigration studies cato institute wouldnt eligible pardon committed offense unlawfully present country quoteven subsequently received green card citizenshipquot pardons language excludes people tourists lawfully permanent residentsp pspannoncitizens comprise significant share people federal marijuana possession records 20152021 sentencing commission ussc spanspana hrefhttpsreasoncomwpcontentuploads202210federaloffendersineachdistrict1pdfrecordeda 6276 federal offenders marijuana possession charges hrefhttpsreasoncomwpcontentuploads202210federaloffendersineachdistrict2pdflisteda 4341roughly 70 percentas noncitizen offenders nearly reported districts usmexico border number noncitizen marijuana possession offenders hrefhttpsidausscgovanalyticssawdlldashboardusscaskidacustompopupclosedroppeda 1670 fy 2015 fy 2021spanp pspana ussc report covering fy 2013 spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanfoundspanaspan 943 percent border offenders noncitizens 165 percent nonborder offenders quotnearly allquot marijuana simple possession offenders apprehended border year quothad little prior criminal historyquot carrying median weight 485 pounds marijuana ussc hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfsaysa quotdoes appear correspond simple possessionquotspanp pspanrather spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanresultspanaspan quotmarijuana drug trafficking cases offender sentenced possession offensequot ussc reports nearly 98 percent simple possession offenders border fiscal year 2013 spana hrefhttpswwwusscgovsitesdefaultfilespdfresearchandpublicationsresearchpublications2016201609_simplepossessionpdfspanreceivedspanaspan prison time median sentence months 264 percent nonborder offenders got jail time year 2016 hrefhttpsdrugpolicyorgsitesdefaultfilesdpa20fact20sheet_the20drug20war20and20mass20deportation_28feb20201629pdfreporta drug policy alliance dpa 1 percent deported drug traffickersspanp pby contrast dpa notes simple marijuana possession quotthe common cause deportation drug law violationsquot 2013 failing pardon people arent citizens lawful permanent residents keeps risk removal quota pardon wipes grounds deportability noncitizenquot says bier noncitizens quotlegal permanent resident status eg refugees asylees etc deportable based solely marijuana convictionquotp pspanthats true noncitizens state federal marijuana records according transactional records access clearinghouse syracuse university organization analyzes immigration data 45000 people spana hrefhttpswwwboundlesscomblogbidenmarijuanapardonimmigrationtextfor20now2c20cannabis20possession20is20a20deportable20offenseamptextfrom20200320to20august202018trac20at20syracuse20universityspandeportedspanaspan marijuana possession fy 2003 august 2018 noncitizens consumed sold possessed marijuana spana hrefhttpswwwboundlesscomblogbidenmarijuanapardonimmigrationspanbarredspanaspan entering receive denials citizenship applicationsspanp pspaneven statesand biden administrationhave relaxed stances marijuana use someones immigration status lead spana hrefhttpswwwthemarshallprojectorg20150616getcaughtwithpotfacedeportationspandrastic punishmentsspanaspan drug convictions bidens marijuana announcement spana hrefhttpstwittercompotusstatus1578097880744820736spancalledspanaspan review marijuana classified federal law issued request government bodies review immigration nationality act spana hrefhttpswwwcongressgovbill117thcongresshousebill1614textspanremovespanaspan marijuana use possession distribution grounds migrants inadmissibility biden extended pardon noncitizens bier explains immigrants quotstill subject controlled substance grounds inadmissibilityquotspanp pspanbiden rightly spana hrefhttpsreasoncom20221006bidensmarijuanareformsarelongoverduebutwillhavejustamodestimpactspannotesspanaspan marijuana relief help people quotwho denied employment housing educational opportunitiesquot virtue drug convictions line reasoning applies noncitizens citizensspanp pspanquotthere good reason exclude noncitizen orderquot says bier quotthe president lays reasons americans come believe marijuana [possession] convictions lack legitimacy impose unnecessary harms wants apply penalties noncitizens citizens green card holders illegallyquotspanp pthe post relnofollow hrefhttpsreasoncom20221010bidensayshespardoningallfederalweedpossessionoffendersheisntbiden says hes pardoning federal weed possession offenders isnta appeared relnofollow hrefhttpsreasoncomreasoncomap

63449d84bbfa3cbde0a21b02

Biden vows continued aid to Ukraine in call after Russian strikes

ppresident biden on monday spoke with ukrainian president volodymyr zelensky to condemn the russian militarys missile strikes in kyiv and nine other ukrainian cities while pledging continued us support for the countryp pbiden expressed his condemnation of russias missile strikes across ukraine including in kyiv and conveyed his condolences to the loved ones of those killed and injured in these senseless attacks the white house said in a readout of the call p pbiden also pledged to continue providing support to ukraine for the country to defend itself amid russias invasion including advanced air defense systems p phe also underscored his ongoing engagement with allies and partners to continue imposing costs on russia holding russia accountable for its war crimes and atrocities and providing ukraine with security economic and humanitarian assistance according to the white housep pzelensky said that the two leaders had a productive conversationp pair defense is currently the number 1 priority in our defense cooperation we also need us leadership with the g7s tough stance and with support for our un ga resolution zelensky a hrefhttpstwittercomzelenskyyuastatus1579547763255443456said in a statement on twitterap pthe ukrainian president is set to address the group of seven g7 nations in an emergency meeting following the russian strikesp pcongress has passed more than 53 billion in security economic and humanitarian assistance for ukraine this year last month a dataidhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution hrefhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution datatypeurl123 billionaa hrefhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution in security and financial assistancea to the country was included in the continuing resolution to fund the government through dec 16p pin a statement earlier on monday biden a dataidhttpsthehillcomhomenewsadministration3681393bidencondemnsrussiamissilestrikesreenforcessupportforukraine hrefhttpsthehillcomhomenewsadministration3681393bidencondemnsrussiamissilestrikesreenforcessupportforukraine datatypeurlformally condemned russias latest attacksa and rebuked moscow for its quotbrutalityquot calling on russia to end the war and remove its troops from ukraine while offering his condolences to the victimsp prussia a relnoreferrer noopener hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosion target_blanklaunched the missiles in apparent retaliationa for an attack on a bridge linking russia to the occupied crimean peninsula which russia annexed in 2014 the missile strikes mark a dramatic escalation after russian troops were recently pushed back thousands of miles amid ukraines successful counteroffensivep prussian president vladimir putin a relnoreferrer noopener hrefhttpsthehillcompolicyinternational3681470putinsharshretaliatorystrikesonukraineescalatestensions target_blankcharacterized the rocket attacks on mondaya as a harsh response to the explosion on the bridge the escalation also comes as the united states has raised alarms about the prospect of nuclear confrontationp

ppresident biden monday spoke ukrainian president volodymyr zelensky condemn russian militarys missile strikes kyiv ukrainian cities pledging continued support countryp pbiden expressed condemnation russias missile strikes ukraine including kyiv conveyed condolences loved ones killed injured senseless attacks white house said readout callp pbiden pledged continue providing support ukraine country defend amid russias invasion including advanced air defense systemsp phe underscored ongoing engagement allies partners continue imposing costs russia holding russia accountable war crimes atrocities providing ukraine security economic humanitarian assistance according white housep pzelensky said leaders productive conversationp pair defense currently number 1 priority defense cooperation need leadership g7s tough stance support un ga resolution zelensky hrefhttpstwittercomzelenskyyuastatus1579547763255443456saidin statementon twitterap pthe ukrainian president set address group seven g7 nations emergency meeting following russian strikesp pcongress passed 53 billion security economic humanitarian assistance ukraine year month dataidhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution hrefhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution datatypeurl123 billionaa hrefhttpsthehillcompolicydefense3663008123billionforukraineincludedincontinuingresolution security financial assistancea country included continuing resolution fund government dec 16p pin statement earlier monday biden dataidhttpsthehillcomhomenewsadministration3681393bidencondemnsrussiamissilestrikesreenforcessupportforukraine hrefhttpsthehillcomhomenewsadministration3681393bidencondemnsrussiamissilestrikesreenforcessupportforukraine datatypeurlformally condemned russias latest attacksa rebuked moscow quotbrutalityquot calling russia end war remove troops ukraine offering condolences victimsp prussiaa relnoreferrer noopener hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosion target_blanklaunched missilesin apparent retaliationafor attack bridge linking russia occupied crimean peninsula russia annexed 2014 missile strikes mark dramatic escalation russian troops recently pushed thousands miles amid ukraines successful counteroffensivep prussian president vladimir putina relnoreferrer noopener hrefhttpsthehillcompolicyinternational3681470putinsharshretaliatorystrikesonukraineescalatestensions target_blankcharacterized rocket attacks mondayaas harsh responseto explosion bridge escalation comes united states raised alarms prospect nuclear confrontationp

63449dc8bbfa3cbde0a21b0a

PayPal Says It Won't Fine Users $2,500 for Misinformation, but It Will Fine Them for 'Intolerance'

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_422095472400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_422095471200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_42209547600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_42209547331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_422095472400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_422095471200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_42209547600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_42209547331x186jpg 331w img width1200 altusing paypal srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpg height675 picture div ppaypal is a company that facilitates financial transactions peter thiel and elon musk billionaire entrepreneurs who have both talked about the importance of free speech and civil liberties have been involved in the company at various stagesp plast week paypal rolled out an a hrefhttpswwwdailywirecomnewsnewpaypalpolicyletscompanypull2500fromusersaccountsiftheypromotemisinformationupdated user agreementap pthat agreement prohibits quotthe sending posting or publication of any messages content or materialsquot that quotpresent a risk to user safety or wellbeingquot or contain quotmisinformationquot the policy notes that what counts as misinformation is at paypals quotsole discretionquot violate the policy and paypal can deduct 2500 from the offending users accountp pthats 2500 emper eminfraction someone who spreads quite a bit of socalled misinformation could stand to lose a great deal of moneyp ppaypal has now backtrackedp pquotan aup notice recently went out in error that included incorrect informationquot a paypal spokesperson said quotpaypal is not fining people for misinformation and this language was never intended to be inserted in our policyquotp pthats a welcome clarification because the policy as written was deeply misguidedp pefforts to police misinformation are prone to significant error and overreach governments media organizations and tech platforms have all made serious attempts to limit the spread of misinformation by cracking down on speech they thought was wrong or dangerousbut time and time again these measures have resulted in censorship of legitimate discoursep pfacebook a hrefhttpsreasoncom20210604lableakmisinformationmediafaucicovid19for instancea took great pains to prevent users from theorizing that covid19 emerged from a lab twitter faced pressure from the biden administration to purge accounts that criticized the mainstream consensus on vaccines masks and other subjects youtubes policies prohibited content creators from spreading socalled covid19 misinformation including statements like quotmasks dont workquot or quotcovid19 is no more dangerous than the fluquot some of those statements have more validity than others but theyre no longer considered outside the bounds of acceptable conversation what the gatekeepers termed quotmisinformationquot is now just informationp pthe governments socalled misinformation experts have performed no better than media organizations or social media platforms remember a hrefhttpsreasoncom20220518disinformationboardninajankowicztaylorlorenzpausedhsnina jankowicza who was chosen as director of the department of homeland securitys disinformation governance board though she had wrongly flagged the emnew york postem hunter biden laptop story as fake russian nefariousness the department picked her to advise elite law enforcement and national intelligence on misinformation trendsp pit would be completely reasonable for paypal users to fear that misguided misinformation policing might end up costing them money and the company is welladvised to reverse coursep piframe allowfullscreen srchttpswwwyoutubecomembedmjjepuiwp4featureoembed width500 titlerobby soave paypal threatens to take 2500 from users who promote misinformation height281iframep pthis incident inspired eugene volokh a professor of law at ucla and writer for emthe volokh conspiracyem a hrefhttpsreasoncomvolokh20221009paypalstillthreatens2500finesforpromotingdiscriminatoryintoleranceevenifnotmisinformationto take a closer looka at the policies paypal already has in place what he found alarmed him paypal prohibits quotactivities that relate to the promotion of hate violence racial or other forms of intolerance that is discriminatory or the financial exploitation of a crimequotp pviolating that policy can also result in a 2500 fine volokh warns that sharply criticizing a religion or government officials could be construed as the promotion of hateand could theoretically violate that policyp pquotsounds like a good reason to think twice about using paypalquot he writes quotive just withdrawn the 1000 i have in my paypal account and im starting the process of disentangling myself from the service to the extent possiblequotp ppaypal is free to put in place whatever policies it thinks are best but the company shouldnt be surprised if people dont trust it to correctly define terms like misinformation hate or intoleranceand thus take their business elsewherep pthe post a relnofollow hrefhttpsreasoncom20221010paypalmisinformationfinehatecensorshippaypal says it wont fine users 2500 for misinformation but it will fine them for intolerancea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_422095472400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_422095471200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_42209547600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_42209547331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_422095472400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_422095471200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_42209547600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_42209547331x186jpg 331w img width1200 altusing paypal srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_42209547800x450jpg height675 picture div ppaypal company facilitates financial transactions peter thiel elon musk billionaire entrepreneurs talked importance free speech civil liberties involved company stagesp plast week paypal rolled hrefhttpswwwdailywirecomnewsnewpaypalpolicyletscompanypull2500fromusersaccountsiftheypromotemisinformationupdated user agreementap pthat agreement prohibits quotthe sending posting publication messages content materialsquot quotpresent risk user safety wellbeingquot contain quotmisinformationquot policy notes counts misinformation paypals quotsole discretionquot violate policy paypal deduct 2500 offending users accountp pthats 2500 emper eminfraction spreads bit socalled misinformation stand lose great deal moneyp ppaypal backtrackedp pquotan aup notice recently went error included incorrect informationquot paypal spokesperson said quotpaypal fining people misinformation language intended inserted policyquotp pthats welcome clarification policy written deeply misguidedp pefforts police misinformation prone significant error overreach governments media organizations tech platforms attempts limit spread misinformation cracking speech thought wrong dangerousbut time time measures resulted censorship legitimate discoursep pfacebook hrefhttpsreasoncom20210604lableakmisinformationmediafaucicovid19for instancea took great pains prevent users theorizing covid19 emerged lab twitter faced pressure biden administration purge accounts criticized mainstream consensus vaccines masks subjects youtubes policies prohibited content creators spreading socalled covid19 misinformation including statements like quotmasks dont workquot quotcovid19 dangerous fluquot statements validity theyre longer considered outside bounds acceptable conversation gatekeepers termed quotmisinformationquot informationp pthe governments socalled misinformation experts performed better media organizations social media platforms remember hrefhttpsreasoncom20220518disinformationboardninajankowicztaylorlorenzpausedhsnina jankowicza chosen director department homeland securitys disinformation governance board wrongly flagged emnew york postem hunter biden laptop story fake russian nefariousness department picked advise elite law enforcement national intelligence misinformation trendsp pit completely reasonable paypal users fear misguided misinformation policing end costing money company welladvised reverse coursep piframe allowfullscreen srchttpswwwyoutubecomembedmjjepuiwp4featureoembed width500 titlerobby soave paypal threatens 2500 users promote misinformation height281iframep pthis incident inspired eugene volokh professor law ucla writer emthe volokh conspiracyem hrefhttpsreasoncomvolokh20221009paypalstillthreatens2500finesforpromotingdiscriminatoryintoleranceevenifnotmisinformationto closer looka policies paypal place found alarmed paypal prohibits quotactivities relate promotion hate violence racial forms intolerance discriminatory financial exploitation crimequotp pviolating policy result 2500 fine volokh warns sharply criticizing religion government officials construed promotion hateand theoretically violate policyp pquotsounds like good reason think twice paypalquot writes quotive withdrawn 1000 paypal account im starting process disentangling service extent possiblequotp ppaypal free place policies thinks best company shouldnt surprised people dont trust correctly define terms like misinformation hate intoleranceand business elsewherep pthe post relnofollow hrefhttpsreasoncom20221010paypalmisinformationfinehatecensorshippaypal says wont fine users 2500 misinformation fine intolerancea appeared relnofollow hrefhttpsreasoncomreasoncomap

63449e0dbbfa3cbde0a21b18

Biden condemns Russia missile strikes, reinforces support for Ukraine

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden on monday condemned the russian militarys missile strikes in kyiv and multiple regions of ukraine reiterating the united states commitment to supporting ukraine amid the escalating warp pthese attacks only further reinforce our commitment to stand with the people of ukraine for as long as it takes alongside our allies and partners we will continue to impose costs on russia for its aggression hold putin and russia accountable for its atrocities and war crimes and provide the support necessary for ukrainian forces to defend their country and their freedom biden said in a statementp prussia a relnoreferrer noopener hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosion target_blanklaunched the missileaa hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosions in apparent retaliationa for an attack on a bridge linking russia to the occupied crimean peninsula which russia annexed in 2014 at least 83 missiles were fired on ukraine on mondayp pbiden in his statement also called on russia to end the war and remove its troops from ukrainep pthe president offered his condolences to the victims calling the killings senseless at least 11 people were killed and dozens more wounded on monday according to ukrainian officialsp pthey once again demonstrate the utter brutality of mr putins illegal war on the ukrainian people biden saidp pthe missile strikes mark a dramatic escalation as russian troops have recently been pushed back thousands of miles amid ukraines successful counteroffensive russian president vladimir putin has come under pressure for the failings of what he calls a special military operationp

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden monday condemned russian militarys missile strikes kyiv multiple regions ukraine reiterating united states commitment supporting ukraine amid escalating warp pthese attacks reinforce commitment stand people ukraine long takes alongside allies partners continue impose costs russia aggression hold putin russia accountable atrocities war crimes provide support necessary ukrainian forces defend country freedom biden said statementp prussiaa relnoreferrer noopener hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosion target_blanklaunched missileaa hrefhttpsthehillcompolicyinternational3680828russiastrikeskyivothercitiesinukraineinwakeofbridgeexplosionsin apparent retaliationa attack bridge linking russia occupied crimean peninsula russia annexed 2014 83 missiles fired ukraine mondayp pbiden statement called russia end war remove troops ukrainep pthe president offered condolences victims calling killings senseless 11 people killed dozens wounded monday according ukrainian officialsp pthey demonstrate utter brutality mr putins illegal war ukrainian people biden saidp pthe missile strikes mark dramatic escalation russian troops recently pushed thousands miles amid ukraines successful counteroffensive russian president vladimir putin come pressure failings calls special military operationp

6345ef3a37947a0d665c7a54

There is nothing progressive about a universal basic income

pthe post a relnofollow hrefhttpswwwspikedonlinecom20221011thereisnothingprogressiveaboutauniversalbasicincomethere is nothing progressive about a universal basic incomea appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap

pthe post relnofollow hrefhttpswwwspikedonlinecom20221011thereisnothingprogressiveaboutauniversalbasicincomethere progressive universal basic incomea appeared relnofollow hrefhttpswwwspikedonlinecomspikedap

63474123657c858ca898f41a

Rising Fascism and the Elections – Chomsky and Ellsberg

a relnofollow hrefhttpstheanalysisnewsrisingfascismandtheelectionschomskyandellsberg titlerising fascism and the elections chomsky and ellsbergimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202210risingfascismusaflag1024x576png width1024 alt srcsethttpstheanalysisnewswpcontentuploads202210risingfascismusaflag1024x576png 1024w httpstheanalysisnewswpcontentuploads202210risingfascismusaflag300x169png 300w httpstheanalysisnewswpcontentuploads202210risingfascismusaflag768x432png 768w httpstheanalysisnewswpcontentuploads202210risingfascismusaflagpng 1281w classwebfeedsfeaturedvisual wppostimage height576apnoam and daniel discuss the rising fascist movement and its roots in american history they analyze the significance of the coming elections and the necessity to vote against overt fascism and continue to organize for more profound political change ellsberg and chomsky on theanalysisnews with paul jay a warning from chomsky and ellsberg chomsky and ellsberg on the death of gorbachev why isp pa relnofollow hrefhttpstheanalysisnewsrisingfascismandtheelectionschomskyandellsbergsourceap

relnofollow hrefhttpstheanalysisnewsrisingfascismandtheelectionschomskyandellsberg titlerising fascism elections chomsky ellsbergimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202210risingfascismusaflag1024x576png width1024 alt srcsethttpstheanalysisnewswpcontentuploads202210risingfascismusaflag1024x576png 1024w httpstheanalysisnewswpcontentuploads202210risingfascismusaflag300x169png 300w httpstheanalysisnewswpcontentuploads202210risingfascismusaflag768x432png 768w httpstheanalysisnewswpcontentuploads202210risingfascismusaflagpng 1281w classwebfeedsfeaturedvisual wppostimage height576apnoam daniel discuss rising fascist movement roots american history analyze significance coming elections necessity vote overt fascism continue organize profound political change ellsberg chomsky theanalysisnews paul jay warning chomsky ellsberg chomsky ellsberg death gorbachev isp pa relnofollow hrefhttpstheanalysisnewsrisingfascismandtheelectionschomskyandellsbergsourceap

6347418d657c858ca898f432

A request about philosophy and two people

pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202210requestforrequests12htmlcomments target_blankymtmjl requesteda that i cover these topicsp div blockquotep1 jeffrey sachsp p2 who are your favorite recentish philosophers other than derek parfitp p3 overunderrated david lewis wvo quine ludwig wittgensteinp p4 when will we get the cwt with scott alexanderpblockquote pin orderp p1 jeffrey sachs is a brilliant and much underrated economist here is a relnoopener hrefhttpsconversationswithtylercomepisodesjeffreysachs target_blankmy early cwt with hima  his work on economic geography and development remains neglected his shock therapy reforms in poland worked they didnt listen to him in russia and the millennium villages project while it did not obviously succeed was a noble and impressive attempt  he deserves a nobel prize for that work  his marginal input in bolivia was positive  that said i find some of his recent comments on chinalab leak and russianordstream deeply objectionable and one can only theorize about what is going on there  in part he imbibed too much new left foreign policy reasoning from the 1960s crew but i dont think that is the entirety of it by any meansp p2 is there any point in my mentioning the obvious famous figures such as kripke bernard williams latour and so on  as for other favorites see cwt  unlike paul mccartney most philosophers will in fact say yes to these dialogues  i also would stress that a lot of the best philosophy is done by driveby commentators on the internet and what is philosophical is the dialogical internet mechanism as a whole as a kind of epistemic computer above and beyond any individuals contributionsp p3 most major philosophers are underrated with the exception of althusser who strangled and murdered his wifep p4 some individuals have been invited who still have not yet said yes  not just paul mccartneyp div pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210arequestaboutphilosophyandtwopeoplehtmla request about philosophy and two peoplea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202210requestforrequests12htmlcomments target_blankymtmjl requesteda cover topicsp div blockquotep1 jeffrey sachsp p2 favorite recentish philosophers derek parfitp p3 overunderrated david lewis wvo quine ludwig wittgensteinp p4 cwt scott alexanderpblockquote pin orderp p1 jeffrey sachs brilliant underrated economist relnoopener hrefhttpsconversationswithtylercomepisodesjeffreysachs target_blankmy early cwt hima work economic geography development remains neglected shock therapy reforms poland worked didnt listen russia millennium villages project obviously succeed noble impressive attempt deserves nobel prize work marginal input bolivia positive said find recent comments chinalab leak russianordstream deeply objectionable theorize going imbibed new left foreign policy reasoning 1960s crew dont think entirety meansp p2 point mentioning obvious famous figures kripke bernard williams latour favorites cwt unlike paul mccartney philosophers fact yes dialogues stress lot best philosophy driveby commentators internet philosophical dialogical internet mechanism kind epistemic computer individuals contributionsp p3 major philosophers underrated exception althusser strangled murdered wifep p4 individuals invited said yes paul mccartneyp div pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210arequestaboutphilosophyandtwopeoplehtmla request philosophy peoplea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

634741c3657c858ca898f438

Biden says Democrats will keep Georgia Senate seat

ppresident biden said wednesday that he thinks democratic sen raphael warnock ga will hold on to his seat while avoiding giving his reaction to the allegations against gop candidate herschel walker that have roiled the racep pnegative and yes biden told reporters when asked about walker and if democrats can hold the seatp pthe presidents remarks were his first time weighing in on the georgia race since the claims against walker become public the daily beast a relnoreferrer noopener hrefhttpswwwthedailybeastcomprolifeherschelwalkerpaidforgirlfriendsabortiongeorgiasenate target_blankreported last weeka that walker conceived a child with a woman he was dating in 2009 and encouraged her to get an abortion p pthe outlet then reported that the same woman is also the mother of one of walkers children and the new york times has since reported that walker pressed for a second abortion the allegations follow previous claims of domestic abuse against the former football starp pwalker is a selfdescribed quotprolifequot candidate and has denied the allegationsp pgeorgia is a pivotal state for democrats in november and in 2020 warnock won in a runoff to solidify democrats majority in the senate biden won the peach state by nearly 12000 votes flipping a state that former president trump won in 2016 by more than 100000 votesp pwarnock this week narrowly pulled ahead of walker according to an a relnoreferrer noopener hrefhttpsemersoncollegepollingcomgeorgia2022senwarnockleadswalkerbytwogovkempleadsabramsbyfive target_blankemerson college pollingthe hill surveya the democrat garnered 48 percent compared to walkers 46 percent which is a 4point improvement for warnock since august when he was trailing walker 44 percent to 46 percentp pmeanwhile senate minority leader mitch mcconnell rky has said a hrefhttpsthehillcomhomenewssenate3683584mcconnellsaysgopwillstickwithwalkerasallegationsroilgeorgiaraceefbfbche will stick with walkera and not pull support for the candidate despite the allegations mcconnell endorsed walker in the gop primary for georgia senate and the candidate has been financially supported by the senate leadership fund a republican pac tied to mcconnellp

ppresident biden said wednesday thinks democratic sen raphael warnock ga hold seat avoiding giving reaction allegations gop candidate herschel walker roiled racep pnegative yes biden told reporters asked walker democrats hold seatp pthe presidents remarks time weighing georgia race claims walker public daily beasta relnoreferrer noopener hrefhttpswwwthedailybeastcomprolifeherschelwalkerpaidforgirlfriendsabortiongeorgiasenate target_blankreported weekathat walker conceived child woman dating 2009 encouraged abortionp pthe outlet reported woman themother walkers children new york times reported walker pressed second abortion allegations follow previous claims domestic abuse football starp pwalker selfdescribed quotprolifequot candidate denied allegationsp pgeorgia pivotal state democrats november 2020 warnock won runoff solidify democrats majority senate biden won peach state nearly 12000 votes flipping state president trump won 2016 100000 votesp pwarnock week narrowly pulled ahead walkeraccording ana relnoreferrer noopener hrefhttpsemersoncollegepollingcomgeorgia2022senwarnockleadswalkerbytwogovkempleadsabramsbyfive target_blankemerson college pollingthe hill surveya democrat garnered 48 percent compared walkers 46 percent 4point improvement warnock august trailing walker 44 percent 46 percentp pmeanwhile senate minority leader mitch mcconnell rky saida hrefhttpsthehillcomhomenewssenate3683584mcconnellsaysgopwillstickwithwalkerasallegationsroilgeorgiaraceefbfbche stick walkeraand pull support candidate despite allegations mcconnell endorsed walker gop primary georgia senate candidate financially supported senate leadership fund republican pac tied mcconnellp

63474231657c858ca898f450

Liz Truss U-turns and fudges through her second PMQs

pin the final weeks of a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsonsa premiership you could feel his authority dissipate in successive prime ministers questions a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagpmqs target_blankpmqsa today was reminiscent of those performances except that a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa is only on her second and she never had much authority to lose p plaughter is the telling sign the guttural welcome from her mps as she approached the dispatch box today was unconvincing and overwrought the prime minister kept saying im genuinely unclear which sounded more like an admission than an indictment of the opposition her own mps could barely suppress their chuckles when not laughing they averted their gazes their faces sullen with despairp pthere was little for them to praise trusss answers lurched from uturn to uturn she said the government emwillem launch a publicity campaign to encourage lower energy use days after refusing to do so she said she emwouldem ban nofault evictions days after briefings suggested otherwisep pthis was not a reset but a repeat of botched arguments truss needed to win the confidence of the markets as well as her mps when a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankthe bank of englandsa monetary intervention ends on friday the markets are set to revolt the government needs to state how the tax cuts announced last month will be paid for and truss only really has two options deep spending cuts or ditching parts of the minibudgetp pshe said today that she would absolutely not cut public spending to bring down debt then said that debt will fall not by cutting public spending but by making sure we spend public money well how will the government make that happen inflation will eat away at public sector budgets in real terms without the nominal level changing for sure but that wont suffice to bring down debt straight after pmqs mel stride the chairman of the treasury select committee stood up in the commons and called for the government a relnoreferrer noopener nofollow hrefhttpstwittercomkitty_donaldsonstatus1580166335752904704 target_blankto reverse the budgets tax announcementsa with trusss authority shot that pressure will only buildp pstrongem[see also a hrefhttpswwwnewstatesmancompoliticsconservatives202210kwasikwartengresignationpriceliztrusssurvivalwill kwasi kwarteng resign to save liz trussa]emstrongp

pin final weeks relnoreferrer noopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsonsa premiership feel authority dissipate successive prime ministers questions relnoreferrer noopener hrefhttpswwwnewstatesmancomtagpmqs target_blankpmqsa today reminiscent performances relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa second authority losep plaughter telling sign guttural welcome mps approached dispatch box today unconvincing overwrought prime minister kept saying im genuinely unclear sounded like admission indictment oppositionher mps barely suppress chuckles laughing averted gazes faces sullen despairp pthere little praise trusss answers lurched uturn uturnshe said governmentemwillemlaunch publicity campaign encourage lower energy use days refusing said sheemwouldemban nofault evictions days briefings suggested otherwisep pthis reset repeat botched arguments truss needed win confidence markets mps relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankthe bank englandsa monetary intervention ends friday markets set revolt government needs state tax cuts announced month paid truss options deep spending cuts ditching parts minibudgetp pshe said today absolutely cut public spending bring debt said debt fall cutting public spending making sure spend public money government happen inflation eat away public sector budgets real terms nominal level changing sure wont suffice bring debt straight pmqs mel stride chairman treasury select committee stood commons andcalledfor government relnoreferrer noopener nofollow hrefhttpstwittercomkitty_donaldsonstatus1580166335752904704 target_blankto reverse budgets tax announcementsa trusss authority shot pressure buildp pstrongem[see hrefhttpswwwnewstatesmancompoliticsconservatives202210kwasikwartengresignationpriceliztrusssurvivalwill kwasi kwarteng resign save liz trussa]emstrongp

6347438b657c858ca898f47e

Is pandemic finally over? We asked the experts.

ppublic health officials agree that the end of the pandemic is in sight but not here yet so where does it leave educators top business executives and public health experts adjusting to a world of constant vigilance for covid flareups accepting hybrid workplaces hustling to make up for lost school time and avoiding lethal inflexibility if the virus mutates into a more deadly threatp pofficials at the world health organization say that many nations have a pretty good handle on whats going on given the spread of vaccines rise of effective treatments and immunity conferred by the large number who have had the disease however they said in late september that both the ongoing global death toll 10000 a week and the prospect that the continuing widespread transmission around the world will spawn a dangerous new variant prevents them from declaring an end to the covid19 emergencyp pwho director general tedros ghebreyesus and maria van kerkhove technical lead of whos pandemic response said that though the advent of vaccines and effective treatments have transformed the fight against the ailment doses remain scarce in some low and middleincome nations and the more the virus circulates they said the more chances it has to mutate into something worrisomep pthe refrain of the pandemic has been that no one is safe until everyone is safe ghebreyesus said during a media briefing the pandemic is not over but the end is in sightp pa hrefhttpswwwhsphharvardeduwilliamhanagewilliam hanagea associate professor of epidemiology and codirector of the a hrefhttpwwwhsphharvardeduharvard th chan school of public healthas a hrefhttpsccddhsphharvardeducenter for communicable disease dynamicsa said despite the temptation to consider the pandemic over past lessons caution us to wait and see last winters omicron variant provided an unforgettable example of the need to not let our attention wander though not as virulent as other variants omicrons constellation of mutations stunned scientists when it appeared last fall and fueled its breathtaking spread around the world in the weeks that followed it rapidly displaced earlier variants and though not as dangerous on a casebycase basis the sheer number of infections it caused have made omicron much more deadlyp pthe thing which most people would be nervously looking for is the possibility of a variant that has properties like omicron in terms of being able to infect lots of people but which also is more dangerous in the way that delta was hanage said if omicron had been as virulent as delta things would have been much worsep pomicron has also proven disturbingly prolific and subvariants continue to emerge who officials said that though omicron represents 99 percent of all sarscov2 out there today there are some 300 omicron subvariants that are being monitored including ba5 widespread in the us ba275 and its subvariants ba46 and its subvariants and bf7 itself a subvariant of ba5p pwith much of the world either infected or vaccinated the who tallies some 127 billion doses given the pandemics ebb and flow is determined by a complex relationship among variants by rising and falling immunity among humans and by apparent seasonal effects hanage saidp aside divif omicron had been as virulent as delta things would have been much worsediv div william hanage associate professor of epidemiology codirector of the center for communicable disease dynamicsdiv aside pvariants that spread rapidly gain the upper hand by efficiently infecting those still uninfected and those vaccinated or recovered whose immunity has waned over time as people gain immunity to the new strain the rate of infection slows eventually favoring other variants that may not spread as rapidly but that better escape the bodys immune responsep pin the us that complex dance appears to be playing out now hanage said with the fastspreading ba5 subvariant appearing to have run its course while ba46 which has greater ability to evade immune defenses is beginning to spread more widelyp pwith each of the past two winters seeing large surges in cases whose peak case counts came within days of each other hanage said its reasonable to expect something similar this fall and winter even though widespread immunity and availability of a new variantupdated vaccine makes it unclear what that will look like in terms of cases hospitalizations and deaths given recent trends its likely that illness will be less severe than earlier in the pandemic though hanage cautioned that even mild illness spread widely enough can be disruptivep pif everybody in the world got the common cold at the same time it would be a big deal hanage said thats the thing about a pandemic of this nature its not so much the individual fatality rate its the fact that a respiratory virus is capable of infecting lots of people very quickly and that means as with omicron flight crews all go down at the same time because they tend to hang out with each other same thing with health care workers on a particular ward same thing with teachersp pit is that backdrop of global uncertainty that has hanage warning against lethal inflexibility while hoping the current lull turns out to be more than that americans should get on with their lives but with an eye on the global and national pandemic situation in fact hanage said it is only the pandemics already staggering toll that makes todays fatality rates appear good by comparison the virus has already killed more than 200000 americans this year hanage said a rate more than four times that of a bad flu seasonp aside divthe overriding goal for this year is that school should look and feel a lot like it did prior to the pandemicdiv div joseph allen associate professor of exposure assessment sciencediv aside peven should a surge emerge hanage and a hrefhttpswwwhsphharvardedujosephallenjoseph allena associate professor of exposure assessment science at the harvard chan school and a healthybuildings expert said clear damage already done to childrens education coupled with the low risk of serious illness for such a young population means there should be a high bar set for steps that cause further disruptionp pthe cost of school closures has been devastating to kids talk to any parent allen said and whether its a secondgrader who has never had normal school or high schoolers who have missed sports or special events like a prom or just social gatherings with friends this has had major impacts the overriding goal for this year is that school should look and feel a lot like it did prior to the pandemicp pa hrefhttpswwwgseharvardedufacultymartinwestmartin westa henry lee shattuck professor of education academic dean at the a hrefhttpwwwgseharvardeduharvard graduate school of educationa and member of the national assessment governing board which oversees the national assessment of educational progress said augusts dismal test results from the nations 9yearolds was expected given the widespread pandemic disruptions to schooling but nonetheless disturbingp pthey show substantial declines in math and reading achievement for the average student in the case of math thats the first time that student scores have declined in the 50year history of the longterm trends assessment west said not only were the average declines substantial there were big differences in the amount of ground lost by higher and lowerachieving studentsp pthough the tests were only for 9yearolds other tests indicate such declines were pervasive in elementary and middle school in high schools there are other indicators of lost progress such as increasing numbers of dropouts and lower numbers enrolling in collegep psince inperson schooling restarted last year children appear to have resumed their prior progress but that bit of good news doesnt address the deficit they had coming back to their classrooms he said that can only be made up through additional instructional hoursp pwest said he would never rule out masking school closures or other steps should the need arise but he thought risk might be balanced differently today than earlier in the pandemic with effective tools to fight pandemic illness and a better understanding of the risk of staying out of schoolp pin retrospect over the course of the pandemic we seem to have underestimated the costs of school closures and perhaps also overestimated the value of school closures in preventing the worst consequences of the pandemic west saidp aside divshould people have to quarantine and theyre not very sick theyll keep at it weve already seen a reduction in absenteeism with the presence of remote workdiv div tsedal neeley professor of business administration senior associate dean for faculty development and researchdiv aside pa hrefhttpswwwhbsedufacultypagesprofileaspxfacid438575tsedal neeleya a hrefhttpwwwhbseduharvard business schoolsa naylor fitzhugh professor of business administration and senior associate dean for faculty development and research said that though another surge remains possible businesses and workers are looking ahead not to more potential temporary measures but to what the permanent postpandemic workplace will look likep pwhile labor days unofficial end of summer marked a time when many businesses required previously remote workers to return to the office what that return looks like varies from place to place whats become apparent said neeley who wrote a 2021 book on remote work is that the hybrid model where professionals particularly socalled knowledge workers spend a couple of days in the office each week and the rest working remotely has wonp pmany bosses she said would prefer workers return fulltime or at least most of the time citing the need for inperson collaboration to oversee and motivate staffs and to foster corporate culture but one indelible pandemic lesson is that employees can be effective working remotely and despite some wobbles the economy continues to favor workers over employersp pmany companies thought that they would have an upper hand because of the economic uncertainties but employees continue to have power because the right people are still hard to hire and retain neeley said because of those dynamics employers dont have the number of people that they need in order to meet their objectives its kind of a tricky placep pa plus of the emerging hybrid workplace neeley said is that it bakes flexibility into knowledge workers practices and keeping remote work part of the picture keeps that workforce resilient against a pandemic resurgencep pshould people have to quarantine and theyre not very sick theyll keep at it weve already seen a reduction in absenteeism with the presence of remote work neeley said the norms around digital tools have been so well established that itll be quite seamlessp

ppublic health officials agree end pandemic sight leave educators business executives public health experts adjusting world constant vigilance covid flareups accepting hybrid workplaces hustling lost school time avoiding lethal inflexibility virus mutates deadly threatp pofficials world health organization nations pretty good handle whats going given spread vaccines rise effective treatments immunity conferred large number disease said late september ongoing global death toll 10000 week prospect continuing widespread transmission world spawn dangerous new variant prevents declaring end covid19 emergencyp pwho director general tedros ghebreyesus maria van kerkhove technical lead whos pandemic response said advent vaccines effective treatments transformed fight ailment doses remain scarce low middleincome nations virus circulates said chances mutate worrisomep pthe refrain pandemic safe safe ghebreyesus said media briefing pandemic end sightp pa hrefhttpswwwhsphharvardeduwilliamhanagewilliam hanagea associate professor epidemiology codirector hrefhttpwwwhsphharvardeduharvard th chan school public healthas hrefhttpsccddhsphharvardeducenter communicable disease dynamicsa said despite temptation consider pandemic past lessons caution wait winters omicron variant provided unforgettable example need let attention wander virulent variants omicrons constellation mutations stunned scientists appeared fall fueled breathtaking spread world weeks followed rapidly displaced earlier variants dangerous casebycase basis sheer number infections caused omicron deadlyp pthe thing people nervously looking possibility variant properties like omicron terms able infect lots people dangerous way delta hanage said omicron virulent delta things worsep pomicron proven disturbingly prolific subvariants continue emerge officials said omicron represents 99 percent sarscov2 today 300 omicron subvariants monitored including ba5 widespread ba275 subvariants ba46 subvariants bf7 subvariant ba5p pwith world infected vaccinated tallies 127 billion doses given pandemics ebb flow determined complex relationship variants rising falling immunity humans apparent seasonal effects hanage saidp aside divif omicron virulent delta things worsediv div william hanage associate professor epidemiology codirector center communicable disease dynamicsdiv aside pvariants spread rapidly gain upper hand efficiently infecting uninfected vaccinated recovered immunity waned time people gain immunity new strain rate infection slows eventually favoring variants spread rapidly better escape bodys immune responsep pin complex dance appears playing hanage said fastspreading ba5 subvariant appearing run course ba46 greater ability evade immune defenses beginning spread widelyp pwith past winters seeing large surges cases peak case counts came days hanage said reasonable expect similar fall winter widespread immunity availability new variantupdated vaccine makes unclear look like terms cases hospitalizations deaths given recent trends likely illness severe earlier pandemic hanage cautioned mild illness spread widely disruptivep pif everybody world got common cold time big deal hanage said thats thing pandemic nature individual fatality rate fact respiratory virus capable infecting lots people quickly means omicron flight crews time tend hang thing health care workers particular ward thing teachersp pit backdrop global uncertainty hanage warning lethal inflexibility hoping current lull turns americans lives eye global national pandemic situation fact hanage said pandemics staggering toll makes todays fatality rates appear good comparison virus killed 200000 americans year hanage said rate times bad flu seasonp aside divthe overriding goal year school look feel lot like prior pandemicdiv div joseph allen associate professor exposure assessment sciencediv aside peven surge emerge hanage hrefhttpswwwhsphharvardedujosephallenjoseph allena associate professor exposure assessment science harvard chan school healthybuildings expert said clear damage childrens education coupled low risk illness young population means high bar set steps cause disruptionp pthe cost school closures devastating kids talk parent allen said secondgrader normal school high schoolers missed sports special events like prom social gatherings friends major impacts overriding goal year school look feel lot like prior pandemicp pa hrefhttpswwwgseharvardedufacultymartinwestmartin westa henry lee shattuck professor education academic dean hrefhttpwwwgseharvardeduharvard graduate school educationa member national assessment governing board oversees national assessment educational progress said augusts dismal test results nations 9yearolds expected given widespread pandemic disruptions schooling nonetheless disturbingp pthey substantial declines math reading achievement average student case math thats time student scores declined 50year history longterm trends assessment west said average declines substantial big differences ground lost higher lowerachieving studentsp pthough tests 9yearolds tests indicate declines pervasive elementary middle school high schools indicators lost progress increasing numbers dropouts lower numbers enrolling collegep psince inperson schooling restarted year children appear resumed prior progress bit good news doesnt address deficit coming classrooms said additional instructional hoursp pwest said rule masking school closures steps need arise thought risk balanced differently today earlier pandemic effective tools fight pandemic illness better understanding risk staying schoolp pin retrospect course pandemic underestimated costs school closures overestimated value school closures preventing worst consequences pandemic west saidp aside divshould people quarantine theyre sick theyll weve seen reduction absenteeism presence remote workdiv div tsedal neeley professor business administration senior associate dean faculty development researchdiv aside pa hrefhttpswwwhbsedufacultypagesprofileaspxfacid438575tsedal neeleya hrefhttpwwwhbseduharvard business schoolsa naylor fitzhugh professor business administration senior associate dean faculty development research said surge remains possible businesses workers looking ahead potential temporary measures permanent postpandemic workplace look likep pwhile labor days unofficial end summer marked time businesses required previously remote workers return office return looks like varies place place whats apparent said neeley wrote 2021 book remote work hybrid model professionals particularly socalled knowledge workers spend couple days office week rest working remotely wonp pmany bosses said prefer workers return fulltime time citing need inperson collaboration oversee motivate staffs foster corporate culture indelible pandemic lesson employees effective working remotely despite wobbles economy continues favor workers employersp pmany companies thought upper hand economic uncertainties employees continue power right people hard hire retain neeley said dynamics employers dont number people need order meet objectives kind tricky placep pa plus emerging hybrid workplace neeley said bakes flexibility knowledge workers practices keeping remote work picture keeps workforce resilient pandemic resurgencep pshould people quarantine theyre sick theyll weve seen reduction absenteeism presence remote work neeley said norms digital tools established itll seamlessp

634892e1ed25724cc9a2881a

As good as gold

pthe dollar is king this year the strength of the us currency has humbled the yen the euro and the pound sterling us interest rates are putting pressure on dollar debtors around the worldp pthis is not a surprise it is often said that the dollar wins whatever the state of the world economy it is a safe haven in crisis in a boom money surges into the dollar because us business is the prime generator of profits but what is increasingly hard to ignore is how the dollars monetary preeminence is out of proportion to americas actual economic standing in the worldp pthanks to the explosive growth of emerging markets such as a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagchina target_blankchinaa and a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagindia target_blankindiaa the world economy is increasingly multipolar as a result the us accounts for little more than 20 per cent of global gdp and yet its share of currency reserves is closer to 60 per cent and the dollar is involved in 85 per cent of all foreign currency transactions if currency is conventionally thought of as an attribute of sovereignty then this preponderance of the dollar would seem to confirm the continued existence of a us financial empire and yet in 2022 this is at odds with americas polarised and dysfunctional politics and the great power competition it faces abroad it seems almost anachronistic that the federal reserve still functions as the de facto central bank of the world like a hangover from the era of the marshall plan in the mid20th century or the moment of unipolarity in the 1990sp phow long can this anomaly continue are there alternatives to the dollar in times of war the question becomes an urgent onep pat the start of 2022 economists debated the possibility of a sinorussian axis with india as a potential third member and a new currency system based on commodities such as oil wheat or minerals cryptocurrencies were touted as the unpolitical private alternativep psuch speculation has faded and the exchange rate of the us currency is once more a dominant force on the world economy talk of alternatives to the dollar seems like an exercise in wishful or alarmist thinking a sign of an unease with an unbalanced world rather than a realistic analysis of likely macroeconomic trendsp pstrongem[see also a hrefhttpswwwnewstatesmancombusinessfinance202210pensionfundsafeukfinancialcrisisis your pension safea]emstrongp pthe century of dollar dominance has always been marked by controversy the dollar emerged as the commanding world currency owing to the first and second world wars while the europeans and japanese consumed themselves in conflict the americans were war profiteers that did not endear them to the rest of the worldp pfor the british elite in the wake of the battle of the somme in 1916 the realisation that the future of the war effort and with it the empire hinged on american money came as an unholy shock in france in the 1920s american tourists were both loved and hated for their purchasing power trotsky mocked the way europes old elite humbled themselves before midwestern bankers such as charles dawes who brokered the reparations settlement with germany of 1924 things were not helped by americas aggressive deflations first in 1920 and again in 1929 which tipped the world into recession and by the ludicrously dysfunctional american policy mixp pfullblown isolationism would at least have been consistent instead while the american government refused to muddy its hands with the difficult business of reparations wall street lent to european governments and businesses on a vast scale meanwhile congress imposed rigorous protectionism making it impossible to service those debts by 1933 not just hitlers regime but the governments of britain and france had defaulted on their debts to the usp pwhen it came to devising a new currency system for the world after the second world war john maynard keynes was determined to avoid dollar hegemony to tame americas capricious policy he proposed a system that would subject everyone to the same pressure to adjust domestic policy to international economic constraints it is an idea that has repeatedly resurfaced most significantly in 2009 in chinese demands for a new currency system to be based on a synthetic global currency presumably managed by the imf or another global body but the idea never stood a chance even under the gold standard in the pomp of its power after 1945 washington was not going to accept its subordination to a global monetary corsetp pinstead from the 1950s onwards the gold reserves of fort knox were used to anchor the dollar and the rest of the worlds currencies that were pegged to the us currency this made the us currency as good as gold provoking protests from the french about exorbitant privilege it was a highly unstable arrangement how could the fed a national central bank which had a commitment to national stability ensure enough liquidity for a global system as the belgian economist robert triffin pointed out in 1960 if the fed acted to correct excess demand in the us it risked choking off the world economy once again the call went up world stability depended on a universal currency in the 1960s the imf created a synthetic global currency the sdr but like esperanto it never caught on instead the system was held together with swap lines that allowed the fed to provide dollars to fellow central banks in addition to other interventions such as bans on open trading in goldp pthen in 1971 facing even larger deficits than in the 1960s richard nixon the president simply abandoned the dollar peg global currencies gyrated wildly but as the white house tapes recorded nixon said he didnt give a s about the lira the dollar plunged the price of dollardenominated commodities like oil surged the organisation of the petroleum exporting countries opec considered repricing oil in another currency but the shift never happened no one else wanted to be the global anchor certainly not the germans whose deutsche mark was the obvious alternative the government didnt want to jeopardise germanys status as a champion exporterp pin 1979 paul volcker chairman of the fed finally did the unthinkable to end the inflation that had troubled the us and world economy since the late 1960s he tightened monetary policy driving interest rates up and unleashing the economic crisis that many had long feared the us economy slumped and dollar debtors around the world went into crisis the us had to bail out its own overextended banks yet what emerged from the volcker shock was a new dollar system based on floating exchange rates the further empowerment of wall street and the final defeat of organised labour budget constraints on the us were removed again and from the 1980s it made full use of this freedom borrowing on a huge scale from japan and then from china by the early 2000s analysts were warning of a dollar crisis ahead beijing would surely exercise the whip hand its ownership of trillions of dollars of us treasury securities gave it enraged by natos offer of membership to ukraine and georgia in 2008 vladimir putin suggested a concerted sinorussian raid on the dollar this would entail dumping their holdings of treasuries so as to deliberately crash the market the russians sold out the chinese did notp pthe crisis that year was one internal to the dollar system the meltdown of bank balance sheets but rather than plunging in 2008 the dollar rose from europe to east asia banks around the world were pleading for dollar liquidity the fed obliged dishing out dollars on an epic scale the same thing happened in 2020 faced with the covid crisis the fed flushed the entire global financial system with the dollar as ever instead of overturning dollar hegemony a crisis reinforced the central role of the american currencyp pthe pattern repeated in 2022 in response to a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagukraine2 target_blankputins invasion of ukrainea the us and europe imposed sanctions on russia in an unprecedented move they violated their commitment to honour central bank claims in favour of the russian central bank but after some feverish talk about alternatives to the dollar what has happened instead of selling dollars and fleeing into any other currency global demand for dollars is stronger than everp pstrongem[see also a hrefhttpswwwnewstatesmancombusinessfinance202210housepricecrashtameukrentalmarketcould a house price crash tame the uks rental marketa]emstrongp phow does an inherently unstable system whose emergence from 1916 was resisted and whose end has been repeatedly foretold endure every crisis what is the secret ingredient that holds the dollar system togetherp pthe significance of emmoney and empireem the new book by the economist perry mehrling is that he takes us to the heart of this question like mehrlings previous books emmoney and empireem uses the biography of a leading economist as a device for making a far more general argument in this case mehrlings medium is charles p kindlebergerp figure classwpblockimageimg sizesmaxwidth 590px 100vw 590px srchttpswwwnewstatesmancomwpcontentuploadssites22022107659jpg alt width590 srcsethttpswwwnewstatesmancomwpcontentuploadssites22022107659jpg 630w httpswwwnewstatesmancomwpcontentuploadssites22022107659215x300jpg 215w httpswwwnewstatesmancomwpcontentuploadssites22022107659380x529jpg 380w httpswwwnewstatesmancomwpcontentuploadssites22022107659129x180jpg 129w classwpimage336581 height822figcaptioncharles p kindleberger emphoto by the truman libraryemfigcaptionfigure pkindlebergers career began and took off in the years of the great depression the second world war and the marshall plan disillusioned with washington politics and blacklisted on account of his association with american leftists by mccarthys witch hunts kindleberger made his career in the prestigious economics department of the massachusetts institute of technologyp pkindleberger is best known for his argument that every successful phase in the world financial system has depended on the presence of a willing hegemon the bank of england played this role during empax britannicaem in the 19th century as has the fed in recent decades the disaster of the interwar period which kindleberger chronicled in emthe world in depression 19291939em 1973 was partly down to the fact that there was no equivalent hegemonic central bankp pit is a compelling theory but as mehrling shows talk of hegemony is easily misunderstood hegemony suggests the authority of governments and states and central banks as we know them today are national state institutions but as their history illustrates the state is not a given thing it is made historically and through interactions with interests at large and the boundaries of the state are porous private interests intermingle with state power a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankthe bank of englanda may have been founded in 1694 but it was not nationalised until 1946 the united states did not have a central bank at all until 1913 its financial system was regionalised new york was umbilically connected to the city of london the regional fed branches in the united states are to this day stacked with business executives from the districts they represent only the fed board in washington dc is a truly public institutionp pkindleberger was trained in the 1920s by a generation of american monetary economists who saw themselves as simultaneously helping to engineer a nationally integrated us financial system centred on the fed and a global financial system centred on the dollar the first world war both created the us national financial system and began to remake the international system around the us as the centre of finance shifted from london to wall street the dollar emerged according to kindleberger not so much as a national currency foreign to the rest of the world in which they nevertheless borrowed lent and transacted but as the native currency of the 20thcentury global financial system in this sense the dollar was truly a successor to gold the common denominator of the pre1914 londonbased regimep pas mehrling argues kindleberger is best thought of less as an international economist than as a cosmopolitan economic thinker to describe the world economy and its currency system as international implies that its building blocks are national economies for kindleberger what counted was the mesh of private financial transactions running from commercial centre to commercial centre across national boundaries and in whatever currency happened to be most convenient and offer attractive marginsp pkindleberger was at odds with both the monetarist and keynesian spirit of the post1945 period despite their differences over how best to control inflation and manage unemployment both main schools of macroeconomics focused on the stabilisation of the national economy while international connections were of secondary import the world economy appeared as a series of national islands rather than what hyun song shin a senior economist at the bank for international settlements would later call the interlocking matrix of private balance sheetsp pfor much of his working life kindleberger was an economist at odds with his times his career spanned the heyday of the national economy between the 1930s and the 1980s whereas his conception of the economy was better suited to the world of globalisation before 1914 and the second phase of globalisation from the 1970sp pthis tension was evident in kindlebergers confident insistence that far from being doomed by americas budget deficit and its trade imbalance the bretton woods international monetary system could be saved what the us authorities needed to do was not to impose national restrictions on capital flows on the contrary the key was to trust to the logic of the uscentred financial system some money might flow out in the shortterm but it would come back and the safest way to ensure that was to not prevent its exit after all where was largescale global money to go then as now there was no real alternative to the dollarp pfor kindleberger nixons freeing of the dollar from gold the deliberate destruction of an international monetary system for the sake of national economic and political priorities was the disastrous denouement of the national economic point of view but his own alarm also proved to be overdone rather than tearing the world economy apart the end of bretton woods would confirm kindlebergers basic point the resilience of the dollar system lies not in the robust health of the us national economy or its national politics but in the strength of global financial network that is woven in dollars and the willingness of the fed to support that network as a lender of last resortp pthis remains the central insight today when we evaluate the world economy and conclude that the dollars role in global finance is disproportionate to its share of global gdp that americas trade deficit is unsustainable that congressional politics is a mess and presidential leadership is dangerously erratic we are conflating two fundamentally incommensurate visions of the world economy the one cosmopolitan the other national or international the resilience of the dollar is preeminently the effect of a cosmopolitan power structure and as mehrling writes while the united states may well have become unable to lead the global dollar system not only survives but expands as private actors find ways through derivatives trades to insulate themselves against national shocks and the network of central banks centred on the fed finds ever new instruments to put a floor underneath the muddlep pstrongem[see also a hrefhttpswwwnewstatesmancombusiness202210costliztrussenergyplanpricecapthe true cost of liz trusss energy price cap plana]emstrongp

pthe dollar king year strength currency humbled yen euro pound sterling interest rates putting pressure dollar debtors worldp pthis surprise said dollar wins state world economy safe haven crisis boom money surges dollar business prime generator profits increasingly hard ignore dollars monetary preeminence proportion americas actual economic standing worldp pthanks explosive growth emerging markets relnoreferrer noopener hrefhttpswwwnewstatesmancomtagchina target_blankchinaa relnoreferrer noopener hrefhttpswwwnewstatesmancomtagindia target_blankindiaa world economy increasingly multipolar result accounts little 20 cent global gdp share currency reserves closer 60 cent dollar involved 85 cent foreign currency transactions currency conventionally thought attribute sovereignty preponderance dollar confirm continued existence financial empire 2022 odds americas polarised dysfunctional politics great power competition faces abroad anachronistic federal reserve functions de facto central bank world like hangover era marshall plan mid20th century moment unipolarity 1990sp phow long anomaly continue alternatives dollar times war question urgent onep pat start 2022 economists debated possibility sinorussian axis india potential member new currency system based commodities oil wheat minerals cryptocurrencies touted unpolitical private alternativep psuch speculation faded exchange rate currency dominant force world economy talk alternatives dollar like exercise wishful alarmist thinking sign unease unbalanced world realistic analysis likely macroeconomic trendsp pstrongem[see hrefhttpswwwnewstatesmancombusinessfinance202210pensionfundsafeukfinancialcrisisis pension safea]emstrongp pthe century dollar dominance marked controversy dollar emerged commanding world currency owing second world wars europeans japanese consumed conflict americans war profiteers endear rest worldp pfor british elite wake battle somme 1916 realisation future war effort empire hinged american money came unholy shock france 1920s american tourists loved hated purchasing power trotsky mocked way europes old elite humbled midwestern bankers charles dawes brokered reparations settlement germany 1924 things helped americas aggressive deflations 1920 1929 tipped world recession ludicrously dysfunctional american policy mixp pfullblown isolationism consistent instead american government refused muddy hands difficult business reparations wall street lent european governments businesses vast scale congress imposed rigorous protectionism making impossible service debts 1933 hitlers regime governments britain france defaulted debts usp pwhen came devising new currency system world second world war john maynard keynes determined avoid dollar hegemony tame americas capricious policy proposed system subject pressure adjust domestic policy international economic constraints idea repeatedly resurfaced significantly 2009 chinese demands new currency system based synthetic global currency presumably managed imf global body idea stood chance gold standard pomp power 1945 washington going accept subordination global monetary corsetp pinstead 1950s onwards gold reserves fort knox anchor dollar rest worlds currencies pegged currency currency good gold provoking protests french exorbitant privilege highly unstable arrangement fed national central bank commitment national stability ensure liquidity global system belgian economist robert triffin pointed 1960 fed acted correct excess demand risked choking world economy went world stability depended universal currency 1960s imf created synthetic global currency sdr like esperanto caught instead system held swap lines allowed fed provide dollars fellow central banks addition interventions bans open trading goldp pthen 1971 facing larger deficits 1960s richard nixon president simply abandoned dollar peg global currencies gyrated wildly white house tapes recorded nixon said didnt s lira dollar plunged price dollardenominated commodities like oil surged organisation petroleum exporting countries opec considered repricing oil currency shift happened wanted global anchor certainly germans deutsche mark obvious alternative government didnt want jeopardise germanys status champion exporterp pin 1979 paul volcker chairman fed finally unthinkable end inflation troubled world economy late 1960s tightened monetary policy driving interest rates unleashing economic crisis long feared economy slumped dollar debtors world went crisis bail overextended banks emerged volcker shock new dollar system based floating exchange rates empowerment wall street final defeat organised labour budget constraints removed 1980s use freedom borrowing huge scale japan china early 2000s analysts warning dollar crisis ahead beijing surely exercise whip hand ownership trillions dollars treasury securities gave enraged natos offer membership ukraine georgia 2008 vladimir putin suggested concerted sinorussian raid dollar entail dumping holdings treasuries deliberately crash market russians sold chinese notp pthe crisis year internal dollar system meltdown bank balance sheets plunging 2008 dollar rose europe east asia banks world pleading dollar liquidity fed obliged dishing dollars epic scale thing happened 2020 faced covid crisis fed flushed entire global financial system dollar instead overturning dollar hegemony crisis reinforced central role american currencyp pthe pattern repeated 2022 response relnoreferrer noopener hrefhttpswwwnewstatesmancomtagukraine2 target_blankputins invasion ukrainea europe imposed sanctions russia unprecedented violated commitment honour central bank claims favour russian central bank feverish talk alternatives dollar happened instead selling dollars fleeing currency global demand dollars stronger everp pstrongem[see hrefhttpswwwnewstatesmancombusinessfinance202210housepricecrashtameukrentalmarketcould house price crash tame uks rental marketa]emstrongp phow inherently unstable system emergence 1916 resisted end repeatedly foretold endure crisis secret ingredient holds dollar system togetherp pthe significance emmoney empireem new book economist perry mehrling takes heart question like mehrlings previous books emmoney empireem uses biography leading economist device making far general argument case mehrlings medium charles p kindlebergerp figure classwpblockimageimg sizesmaxwidth 590px 100vw 590px srchttpswwwnewstatesmancomwpcontentuploadssites22022107659jpg alt width590 srcsethttpswwwnewstatesmancomwpcontentuploadssites22022107659jpg 630w httpswwwnewstatesmancomwpcontentuploadssites22022107659215x300jpg 215w httpswwwnewstatesmancomwpcontentuploadssites22022107659380x529jpg 380w httpswwwnewstatesmancomwpcontentuploadssites22022107659129x180jpg 129w classwpimage336581 height822figcaptioncharles p kindleberger emphoto truman libraryemfigcaptionfigure pkindlebergers career began took years great depression second world war marshall plan disillusioned washington politics blacklisted account association american leftists mccarthys witch hunts kindleberger career prestigious economics department massachusetts institute technologyp pkindleberger best known argument successful phase world financial system depended presence willing hegemon bank england played role empax britannicaem 19th century fed recent decades disaster interwar period kindleberger chronicled emthe world depression 19291939em 1973 partly fact equivalent hegemonic central bankp pit compelling theory mehrling shows talk hegemony easily misunderstood hegemony suggests authority governments states central banks know today national state institutions history illustrates state given thing historically interactions interests large boundaries state porous private interests intermingle state power relnoreferrer noopener hrefhttpswwwnewstatesmancomtagbankofengland target_blankthe bank englanda founded 1694 nationalised 1946 united states central bank 1913 financial system regionalised new york umbilically connected city london regional fed branches united states day stacked business executives districts represent fed board washington dc truly public institutionp pkindleberger trained 1920s generation american monetary economists saw simultaneously helping engineer nationally integrated financial system centred fed global financial system centred dollar world war created national financial system began remake international system centre finance shifted london wall street dollar emerged according kindleberger national currency foreign rest world borrowed lent transacted native currency 20thcentury global financial system sense dollar truly successor gold common denominator pre1914 londonbased regimep pas mehrling argues kindleberger best thought international economist cosmopolitan economic thinker describe world economy currency system international implies building blocks national economies kindleberger counted mesh private financial transactions running commercial centre commercial centre national boundaries currency happened convenient offer attractive marginsp pkindleberger odds monetarist keynesian spirit post1945 period despite differences best control inflation manage unemployment main schools macroeconomics focused stabilisation national economy international connections secondary import world economy appeared series national islands hyun song shin senior economist bank international settlements later interlocking matrix private balance sheetsp pfor working life kindleberger economist odds times career spanned heyday national economy 1930s 1980s conception economy better suited world globalisation 1914 second phase globalisation 1970sp pthis tension evident kindlebergers confident insistence far doomed americas budget deficit trade imbalance bretton woods international monetary system saved authorities needed impose national restrictions capital flows contrary key trust logic uscentred financial system money flow shortterm come safest way ensure prevent exit largescale global money real alternative dollarp pfor kindleberger nixons freeing dollar gold deliberate destruction international monetary system sake national economic political priorities disastrous denouement national economic point view alarm proved overdone tearing world economy apart end bretton woods confirm kindlebergers basic point resilience dollar system lies robust health national economy national politics strength global financial network woven dollars willingness fed support network lender resortp pthis remains central insight today evaluate world economy conclude dollars role global finance disproportionate share global gdp americas trade deficit unsustainable congressional politics mess presidential leadership dangerously erratic conflating fundamentally incommensurate visions world economy cosmopolitan national international resilience dollar preeminently effect cosmopolitan power structure mehrling writes united states unable lead global dollar system survives expands private actors find ways derivatives trades insulate national shocks network central banks centred fed finds new instruments floor underneath muddlep pstrongem[see hrefhttpswwwnewstatesmancombusiness202210costliztrussenergyplanpricecapthe true cost liz trusss energy price cap plana]emstrongp

6349e38a07b848610f8c286c

Is Jordan Peterson Onto Something?

img altis jordan peterson onto something srchttpswisdomofcrowdslivecontentimages202210105335absdljpgpin strongpart 2strong of the podcast we talk about the deep differences in social development between boys and girls for example richard reeves childhood in england included playing chicken with passing trucks while schoolyard rock fights were a daily occurrence during damirs time in croatia hailing from the gentler culture of the philadelphia main line shadi is shocked ppmore seriously we also discussed the way that the right has monopolized thinking about the effects of cultural and societal norms how do liberals relearn discussing the importance of culture can a broken dating market be fixed what does it mean if alienated men increasingly turn to illiberal movements and cultural figures like jordan peterson and finally why is richard cautiously optimistic about the longterm prospects for menppif you missed strongpart 1strong of the episode you can access it stronga hrefhttpswisdomofcrowdslivealltheyoungdudes2hereastrongp

img altis jordan peterson srchttpswisdomofcrowdslivecontentimages202210105335absdljpgpin strongpart 2strong podcast talk deep differences social development boys girls example richard reeves childhood england included playing chicken passing trucks schoolyard rock fights daily occurrence damirs time croatia hailing gentler culture philadelphia main line shadi shocked ppmore seriously discussed way right monopolized thinking effects cultural societal norms liberals relearn discussing importance culture broken dating market fixed mean alienated men increasingly turn illiberal movements cultural figures like jordan peterson finally richard cautiously optimistic longterm prospects menppif missed strongpart 1strong episode access stronga hrefhttpswisdomofcrowdslivealltheyoungdudes2hereastrongp

6349e3a607b848610f8c2870

How to protect democracy? Don’t give up on your neighbor

pat a time when us neighborhoods are a hrefhttpsnewsharvardedugazettestory202103democratsandrepublicansliveinpartisanbubblesstudyfindssegregated by politicsa and different news sources shape views of different issues many americans are tempted to dismiss others as ideological lost causes who arent worth engaging in political discoursep pwrong says anand giridharadas in his new book a hrefhttpsthepersuadersbookcomthe persuaders at the front lines of the fight for hearts minds and democracya the harvard radcliffe fellow argues that debate is a bedrock principle of democracy that we cannot afford to abandon in the face of antidemocratic threatsp pgiridharadas spoke to the gazette about the book and what hell be working on during his time at radcliffe he will speak with deval patrick the former massachusetts governor and now codirector of the center for public leadership at the kennedy school on wednesday at the brattle theatre the interview has been edited for clarity and lengthp h2qampah2 h3anand giridharadash3 pspangazette  spanwhy is persuasion such an essential part of democracyp pspangiridharadasspan for most of human history the dominant idea of how to make decisions about the future was that kings and queens and emperors and tyrants should do it it was too hard too complicated too messy to let all of us make the future through debate and conversation and choice in the last few hundred years there was a radical turn where it became the dominant view that it is best when we make the future people make the future through debate and discussion and argument and then acts of choosing and that these decisions are better made and certainly more legitimately made when everybody gets a say in themp pright now we are at a moment when we are backsliding from that democratic consensus we see a fascist threat rising on the right the political right in the united states is essentially now a fascist movement theres a belief in overturning elections discounting the will of the people that way there is a belief in political violence as a legitimate tool of achieving your ends but also more subtly throughout the culture rather than on just any one side there is a kind of great writeoff where people generally assume that people who disagree with them or are on other sides of various divides are irredeemable are monolithically committed to those views and never going to change we have come to a crisis of persuasion that is in many ways a crisis of liberal democracy if we as society lose faith in the idea that we can change things by changing minds that we can make the future by arguing and haggling and having it out with each other through words and votes then were essentially asking for civil war were asking for tyranny we are asking for these decisions to be made for usp pi became very alarmed by what seemed to me was the rise of a kind of antipersuasive culture this idea that we will never be able to change those who disagree with us and decided to spend time with a bunch of people who have refused the great writeoff organizers and activists and people in politics who are still committed believers in persuasion and changing things by changing mindsp aside divthe fundamental incentive of social media is toward the inflammatory rather than any kind of bridgebuilding or empathetic responsediv divdiv aside pspangazette spanwhats driving our willingness to write each other off so quicklyp pspangiridharadasspan social media is a very big part of the story the fundamental incentive of social media is toward the inflammatory rather than any kind of bridgebuilding or empathetic response its inspired many of us myself included to rely on shame and peer pressure as political modes in ways that have no basis in evidence as being effective it also has to do with billionaireowned media that in a different way has profited from divisionp ptheres also the fact that a politics of civility and comity and having faith in the other side has not really delivered much if youre under 40 theres a reason you see gen z and millennials turning away from those political values i think there is also a sense that there are very wealthy and powerful people which is what i wrote about in my a hrefhttpswwwpenguinrandomhousecombooks539747winnerstakeallbyanandgiridharadasprevious booka who are hellbent on grabbing more and more wealth and power who have done so incredibly effectively appealing to kindness is simply not adequate to the kinds of depredations of that group so for a lot of reasons you have a more strident political culture a more confrontational political culturep pspangazette spanwhich strategies and techniques of persuasion are most effective at cutting through the noisep pspangiridharadasspan one of the most interesting myths is that persuasion has grown impossible it is certainly true that political persuasion is harder in an age of polarization the number of people who flip back and forth certainly between the parties is lower than at other moments in history however on issue after issue there is welldocumented evidence that a significant number of people enough to make an enormous difference in the shape of your life and my life are changing their minds all the time about all kinds of things donald trump won the first time and lost the second time you can say everyone who voted for him is this or everyone who voted for him was that i said as much of that stuff as anybody but it is a fact that some people liked him the first time didnt like him the second time what a lot of organizers are showing is that there is still room to move significant numbers of people maybe not half the population but 5 10 20 30 percent of people on certain issuesp pheres some of what i learned that the prodemocracy movement needs to pick up and embrace one is meeting people where they are having more space in movements for people who dont fully get it who dont use the right terms but their hearts are in the right place who frankly are suspicious or nervous about some of the ideas they hear from portions of the prodemocracy side but who like overt racism and white nationalism even less were often more interested as a movement in policing their entry rather than saying come on inp psecondly i think the prodemocracy side needs to be more conflictprone more willing to pick fights the idea of going high when they go low has been a disaster what you see in folks like [california gov] gavin newsom and others is the hunger a lot of democrats have to see candidates who are able to pick fights and name villains when there are villains its ok to be a little angry and mix it up a little bit for the sake of making peoples lives betterp pspangazette spanboth democrats and republicans are telling prospective voters that democracy is on the ballot in november because of the actions of the other party is that accurate how do you see the midterms shaping upp pspangiridharadasspan just because both sides are telling you the other side is going to end democracy doesnt mean both sides are going to end democracy there may be people who are excited committed fascists in the leadership of the republican party and others who are just fraidy cats but it doesnt really matter if no one is advocating for the view that elections are things that cannot be overturned and political violence is something that plays no part in politicsp pand so the burden for the left and for the prodemocracy side right now is immense it is running to sustain the idea of democratic life of liberal democracy itself and my concern at the heart of this book is that it is not up to the task as it now stands it has the right ideas it has many of the right policies it has its heart in the right place but there is a moral complacency no matter how righteous you think you are no matter how much you may be on the right side of history it is not enough to be right about the future you have to sell it especially to those who are skeptical and what i see is a prodemocracy movement that is not even turning on many of the key engines of persuading people theyre not even really competingp pspangazette spanwhat will you be working on at radcliffe this yearp pspangiridharadasspan all my books are based on my own reporting its exciting to have that firstperson connection to subject matter but it also limits the range of what you can cover so i am attempting something very different its the seed of a book but who knows maybe an art project it may be a documentary i dont know the final form it should take but its an attempt to take a more complex variegated biopsy of the american body politic in this moment of confusion and fracture and pain and aspirationp ppart of the angry confrontational polarized culture we have gotten into is that it makes us forget the complexity of people it causes us to think of other people as facilely being one thing having one story but its almost never true and it diminishes our political possibilities when we start to assume that theres only one story about people im trying to do a project that showcases how complicated people are different americans who in a conventional way would seem to be on different sides of an issue but in fact may have more common than wed thinkp

pat time neighborhoods hrefhttpsnewsharvardedugazettestory202103democratsandrepublicansliveinpartisanbubblesstudyfindssegregated politicsa different news sources shape views different issues americans tempted dismiss ideological lost causes arent worth engaging political discoursep pwrong says anand giridharadas new book hrefhttpsthepersuadersbookcomthe persuaders lines fight hearts minds democracya harvard radcliffe fellow argues debate bedrock principle democracy afford abandon face antidemocratic threatsp pgiridharadas spoke gazette book hell working time radcliffe speak deval patrick massachusetts governor codirector center public leadership kennedy school wednesday brattle theatre interview edited clarity lengthp h2qampah2 h3anand giridharadash3 pspangazette spanwhy persuasion essential democracyp pspangiridharadasspanfor human history dominant idea decisions future kings queens emperors tyrants hard complicated messy let future debate conversation choice years radical turn dominant view best future people future debate discussion argument acts choosing decisions better certainly legitimately everybody gets themp pright moment backsliding democratic consensus fascist threat rising right political right united states essentially fascist movement theres belief overturning elections discounting people way belief political violence legitimate tool achieving ends subtly culture kind great writeoff people generally assume people disagree sides divides irredeemable monolithically committed views going change come crisis persuasion ways crisis liberal democracy society lose faith idea change things changing minds future arguing haggling having words votes essentially asking civil war asking tyranny asking decisions usp pi alarmed rise kind antipersuasive culture idea able change disagree decided spend time bunch people refused great writeoff organizers activists people politics committed believers persuasion changing things changing mindsp aside divthe fundamental incentive social media inflammatory kind bridgebuilding empathetic responsediv divdiv aside pspangazettespanwhats driving willingness write quicklyp pspangiridharadasspansocial media big story fundamental incentive social media inflammatory kind bridgebuilding empathetic response inspired included rely shame peer pressure political modes ways basis evidence effective billionaireowned media different way profited divisionp ptheres fact politics civility comity having faith delivered youre 40 theres reason gen z millennials turning away political values think sense wealthy powerful people wrote hrefhttpswwwpenguinrandomhousecombooks539747winnerstakeallbyanandgiridharadasprevious booka hellbent grabbing wealth power incredibly effectively appealing kindness simply adequate kinds depredations group lot reasons strident political culture confrontational political culturep pspangazettespanwhich strategies techniques persuasion effective cutting noisep pspangiridharadasspanone interesting myths persuasion grown impossible certainly true political persuasion harder age polarization number people flip forth certainly parties lower moments history issue issue welldocumented evidence significant number people enormous difference shape life life changing minds time kinds things donald trump won time lost second time voted voted said stuff anybody fact people liked time didnt like second time lot organizers showing room significant numbers people maybe half population 5 10 20 30 percent people certain issuesp pheres learned prodemocracy movement needs pick embrace meeting people having space movements people dont fully dont use right terms hearts right place frankly suspicious nervous ideas hear portions prodemocracy like overt racism white nationalism interested movement policing entry saying come inp psecondly think prodemocracy needs conflictprone willing pick fights idea going high low disaster folks like [california gov] gavin newsom hunger lot democrats candidates able pick fights villains villains ok little angry mix little bit sake making peoples lives betterp pspangazettespanboth democrats republicans telling prospective voters democracy ballot november actions party accurate midterms shaping upp pspangiridharadasspanjust sides telling going end democracy doesnt mean sides going end democracy people excited committed fascists leadership republican party fraidy cats doesnt matter advocating view elections things overturned political violence plays politicsp pand burden left prodemocracy right immense running sustain idea democratic life liberal democracy concern heart book task stands right ideas right policies heart right place moral complacency matter righteous think matter right history right future sell especially skeptical prodemocracy movement turning key engines persuading people theyre competingp pspangazettespanwhat working radcliffe yearp pspangiridharadasspanall books based reporting exciting firstperson connection subject matter limits range cover attempting different seed book knows maybe art project documentary dont know final form attempt complex variegated biopsy american body politic moment confusion fracture pain aspirationp ppart angry confrontational polarized culture gotten makes forget complexity people causes think people facilely thing having story true diminishes political possibilities start assume theres story people im trying project showcases complicated people different americans conventional way different sides issue fact common wed thinkp

634b36220c5f1e84bf629c15

Legendary Battle of Himera was triumph of Greek heroism, kind of

pin the 480 bc a hrefhttpswwwliviusorgarticlesbattlehimera480bcebattle of himeraa greek forces defeated the invading carthaginians in a victory that ushered in a period of peace and prosperity across their world but while historians such as herodotus hailed the victory as a triumph of greek heroism and fortitude studies of recently discovered mass graves have revealed that the combatants included substantial numbers of nongreek fighters a new study found that the men who died violently likely hailed from as far away as the baltic region and the eurasian steppe giving insights into the nature of these wars and movements of people over extraordinarily long distances in the classical worldp pthe new paper the diverse genetic origins of a classical period greek army published in a hrefhttpswwwpnasorgproceedings of the national academy of sciencesa takes a genomic look at those foreign fighters a previous study used isotopes to identify threequarters of those in the mass graves as nonlocal now the archaeologists from that study including professor of genetics and human evolutionary biology a hrefhttpsreichhmsharvardedudavid reicha cofirst authors a hrefhttpsanthropologyugaedudirectorypeoplelauriereitsemalaurie rietsemaa university of georgia and a hrefhttpswwwuncoeduhssanthropologyaboutfacultybritneykyleaspxbritney kylea university of northern colorado were able to carry out an indepth dive into genomewide data from 16 individuals from these mass graves as well as 38 other ancient people from sicily their analysis revealed that individuals from the mass graves assumed to be largely mercenaries hailed from places as farflung as ukraine the baltic region modernday latvia and thrace modernday bulgaria said reichp pgoing into the study we already had an idea that people from lots of regions must have participated in this battle but there was no clue yet as to where they came from said alissa mittnik the postdoc in reichs lab who led the genetic analysis and another cofirst authorp aside divsuch data is similar in quality data to what one gets from sending your dna to a personal ancestry testing companydiv div david reich professor of genetics and human evolutionary biologydiv aside phistory was no help much was written about this event from the historical records but all historical information has biases said reich documenting the apparent heroism of the greeks at this battle as well as at battles with invading persians around the same time at salamis and thermopylae the other end of the greek world was important to greek identity in this periodp pone aspect of these accounts has been the makeup of the armies while it is known that in this period in time mercenaries were widely used greek historians didnt mention the participation of mercenaries at himera said mittnik they would have been people that would have been considered by the greeks as foreign barbariansp pusing dna mined from bones and teeth the team provides surprising information about the origins of these nongreek fighters we have data from tens of thousands and sometimes even more than a million positions in the genome explained reich such data is similar in quality data to what one gets from sending your dna to a personal ancestry testing company the data allowed the team to compare the ancestry of the people from ancient sicily with the ancestry of others with exquisite accuracy said reichp pcombining the genetic and the isotopic results tells us about the genetic ancestry of people and gives powerful clues about where they grew up for example he said two individuals have ancestry typical of the baltic region at the time two have ancestry typical of the northern balkans and two have ancestry typical of the steppes north of the black seap pthese findings shed light on patterns of movement through the ancient world this provides direct evidence of people traveling long distances in their lifetime and shows that a motivation for such travel would have been not just trade but participation in warfare said mittnikp pwar added reich seems to have drawn people from particularly farflung placesp pfor mittnik who has started her own research group in germany this work fits well within a larger program im interested in using ancient dna to gain insight into the dynamics of communities she said i also work on reconstructing family trees and studying patterns in these pedigrees to learn what they can show about social organizationp preich said the possibilities are global genetic data complement isotopic and archaeological data and by combining them we obtain a richer and more nuanced understanding of the pastp

pin 480 bc hrefhttpswwwliviusorgarticlesbattlehimera480bcebattle himeraa greek forces defeated invading carthaginians victory ushered period peace prosperity world historians herodotus hailed victory triumph greek heroism fortitude studies recently discovered mass graves revealed combatants included substantial numbers nongreek fighters new study found men died violently likely hailed far away baltic region eurasian steppe giving insights nature wars movements people extraordinarily long distances classical worldp pthe new paper diverse genetic origins classical period greek army published hrefhttpswwwpnasorgproceedings national academy sciencesa takes genomic look foreign fighters previous study isotopes identify threequarters mass graves nonlocal archaeologists study including professor genetics human evolutionary biology hrefhttpsreichhmsharvardedudavid reicha cofirst authors hrefhttpsanthropologyugaedudirectorypeoplelauriereitsemalaurie rietsemaa university georgia hrefhttpswwwuncoeduhssanthropologyaboutfacultybritneykyleaspxbritney kylea university northern colorado able carry indepth dive genomewide data 16 individuals mass graves 38 ancient people sicily analysis revealed individuals mass graves assumed largely mercenaries hailed places farflung ukraine baltic region modernday latvia thrace modernday bulgaria said reichp pgoing study idea people lots regions participated battle clue came said alissa mittnik postdoc reichs lab led genetic analysis cofirst authorp aside divsuch data similar quality data gets sending dna personal ancestry testing companydiv div david reich professor genetics human evolutionary biologydiv aside phistory help written event historical records historical information biases said reich documenting apparent heroism greeks battle battles invading persians time salamis thermopylae end greek world important greek identity periodp pone aspect accounts makeup armies known period time mercenaries widely greek historians didnt mention participation mercenaries himera said mittnik people considered greeks foreign barbariansp pusing dna mined bones teeth team provides surprising information origins nongreek fighters data tens thousands million positions genome explained reich data similar quality data gets sending dna personal ancestry testing company data allowed team compare ancestry people ancient sicily ancestry exquisite accuracy said reichp pcombining genetic isotopic results tells genetic ancestry people gives powerful clues grew example said individuals ancestry typical baltic region time ancestry typical northern balkans ancestry typical steppes north black seap pthese findings shed light patterns movement ancient world provides direct evidence people traveling long distances lifetime shows motivation travel trade participation warfare said mittnikp pwar added reich drawn people particularly farflung placesp pfor mittnik started research group germany work fits larger program im interested ancient dna gain insight dynamics communities said work reconstructing family trees studying patterns pedigrees learn social organizationp preich said possibilities global genetic data complement isotopic archaeological data combining obtain richer nuanced understanding pastp

634dd91d29d5126f5ad65025

The Good, the Bad, and the Democratic

img altthe good the bad and the democratic srchttpswisdomofcrowdslivecontentimages20221019281282electioncandidates1jpgpnot all problems have solutions as it turns out democracy is one such problem what makes it great is also apparently what makes it frightening should democracy be as frightening as it has become is there a way to temper it constrain it and make it more digestible for its jittery consumers i think the answer is yeswith caveats brppas many of you know ive been working on a book for almost the entire duration of wisdom of crowds existence life can be judged not in years but in podcast eras a great philosopher once said i dont think this book would have become what it is today without this broader community of likeminded thinkers writers listeners and readers damir pushed me to clarify my priors a word which i had never used prior to meeting damir thats precisely what i tried to do and so i thought and wrote about the democratic idea in the hope of offering up an alternative interpretation of that idea updated for our current moment brppthis past weekend on october 15th marked the culmination of this perhaps overambitious effort my book suggestively titled a hrefhttpswwwamazoncomproblemdemocracyamericamiddleeastdp0197579469linkcodell1tagshtwitter20linkidd93168c08a19942813b7dd06f6f3feb3languageen_usref_as_li_ss_tlemthe problem of democracyemaem emwas officially released im really excited to share it with you and hope that many of you will get a chance to read it one way or another buy it barter for it borrow it from a friend check it out at your local library libraries still exist one hopes this is where i lay it all out on the line to use a sports metaphor although i must confess that i dont know quite which sport this would be a reference to brppwith all that said i wanted to personally invite all of you dear readers and listeners to stop by for the a hrefhttpswwwbrookingsedueventstheproblemofdemocracyislamliberalismandamericanforeignpolicyvirtual launch of the booka today at 4pm est with three scholars who have had a profound influence on me including the great francis fukuyama author of the book on a hrefhttpswisdomofcrowdslivecanliberalismberenewed2liberalisms discontentsa i guess ill be talking about democracys own discontents ill be laying out some of the core arguments of my book and reflecting on how im feeling about democracy or the lack thereof in light of recent developments i expect there will be some constructive disagreement as well the coolest part of this is that anyone who registers to attend will receive a strong30 discountstrong on the book so if the topic interests you do consider tuning in andor getting a copy you can a hrefhttpsconnectbrookingseduregistertowatchdemocracyproblemstrongregister herestronga pdiv dataplaceholdersubscribedivpyou can also submit questions or comments on twitter at a hrefhttpstwittercomsearchq23democracyproblemdemocracyproblema if we dont get to them during the event ill be using the hashtag to engage with readers in the coming days if you want to commend criticize or perhaps even skewer me for my bad or good ideasbrppspeaking of which usually when i use the words bad or good i use scare quotes this isnt to say im some sort of moral relativist god forbid but as time passes i feel increasingly uncomfortable making judgments about what constitutes a good or bad democratic outcome for example id be more agnostic about wokeism if more people actually subscribed to it part of what grates about wokeness is that it has limited democratic legitimacy while also seeming completely uninterested in seeking popular consent of any sort instead it accumulates tremendous political and cultural currency despite being in effect a minority faith there is the madness of crowds but there is also the wisdom of crowds and at least on this the crowds appear to be wiseppi suppose id say that all other things being equal a big if the fact that more rather than less people believe something makes it more legitimate which in a sense makes it more true or at least more likely to be true in a flight of fancy some time back i tweeted the followingppif people keep voting for something assuming it doesnt violate the constitution then its probably not as bad as we think although it could still be a disfavored outcomeppupon rereading this sentence today i found myself thinking wow i said that do i really think that or was i caught up in the moment stretching myself too far and placing a burden on the democratic idea that it couldnt bear for now ill leave this as an openended question because there are different ways of answering it just as not all problems have solutions not all questions need answers at least not right awayp

img altthe good bad democratic srchttpswisdomofcrowdslivecontentimages20221019281282electioncandidates1jpgpnot problems solutions turns democracy problem makes great apparently makes frightening democracy frightening way temper constrain digestible jittery consumers think answer yeswith caveats brppas know ive working book entire duration wisdom crowds existence life judged years podcast eras great philosopher said dont think book today broader community likeminded thinkers writers listeners readers damir pushed clarify priors word prior meeting damir thats precisely tried thought wrote democratic idea hope offering alternative interpretation idea updated current moment brppthis past weekend october 15th marked culmination overambitious effort book suggestively titled hrefhttpswwwamazoncomproblemdemocracyamericamiddleeastdp0197579469linkcodell1tagshtwitter20linkidd93168c08a19942813b7dd06f6f3feb3languageen_usref_as_li_ss_tlemthe problem democracyemaem emwas officially released im excited share hope chance read way buy barter borrow friend check local library libraries exist hopes lay line use sports metaphor confess dont know sport reference brppwith said wanted personally invite dear readers listeners stop hrefhttpswwwbrookingsedueventstheproblemofdemocracyislamliberalismandamericanforeignpolicyvirtual launch booka today 4pm est scholars profound influence including great francis fukuyama author book hrefhttpswisdomofcrowdslivecanliberalismberenewed2liberalisms discontentsa guess ill talking democracys discontents ill laying core arguments book reflecting im feeling democracy lack thereof light recent developments expect constructive disagreement coolest registers attend receive strong30 discountstrong book topic interests consider tuning andor getting copy hrefhttpsconnectbrookingseduregistertowatchdemocracyproblemstrongregister herestronga pdiv dataplaceholdersubscribedivpyou submit questions comments twitter hrefhttpstwittercomsearchq23democracyproblemdemocracyproblema dont event ill hashtag engage readers coming days want commend criticize skewer bad good ideasbrppspeaking usually use words bad good use scare quotes isnt im sort moral relativist god forbid time passes feel increasingly uncomfortable making judgments constitutes good bad democratic outcome example id agnostic wokeism people actually subscribed grates wokeness limited democratic legitimacy completely uninterested seeking popular consent sort instead accumulates tremendous political cultural currency despite effect minority faith madness crowds wisdom crowds crowds appear wiseppi suppose id things equal big fact people believe makes legitimate sense makes true likely true flight fancy time tweeted followingppif people voting assuming doesnt violate constitution probably bad think disfavored outcomeppupon rereading sentence today found thinking wow said think caught moment stretching far placing burden democratic idea couldnt bear ill leave openended question different ways answering problems solutions questions need answers right awayp

634dd92429d5126f5ad65029

Valuing the Deep State Part V: Controlling the Administrative State

img altvaluing the deep state part v controlling the administrative state srchttpswwwamericanpurposecomcontentimages202210screenshot20221017at113537ampngpemfifth article in a series on bureaucratic autonomy the first installment can be found a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea the second a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea the third a hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea and the fourth a hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartivwhydelegationisnecessaryhereaemppmany conservatives argue today that americans are living under the tyranny of an outofcontrol administrative state in which unelected bureaucrats together with their allies in the courts make critical decisions affecting their lives there are in fact any number of ways by which political principals control bureaucratic agents  the real problem is rather different democratically elected legislators want the government to do things without issuing clear mandates as to how that is to be done and they fail to use the controls available to them the bureaucrats are then left to fill in the gaps on their own___steady_paywall___ppkate bersch of davidson college and i have written an article for the emannual review of political scienceem on how to measure bureaucratic autonomy this came out of the a hrefhttpscddrlfsistanfordedugovernancegovernance projecta that i have been leading at stanford university since 2011 which has sought to come up with better measures of state capacity we wanted to capture weberian aspects of bureaucratic quality like autonomy and meritocracy that were often passed over in existing measures and contributed to a survey instrument developed by the global survey of public servants in collaboration with a number of other academic institutionsppkate and i realized that we couldnt adequately measure bureaucratic autonomy because we didnt have a theory of what bureaucratic autonomy was so in the course of writing the article we dove into the academic literature in administrative law to understand how political principals control bureaucratic agents in the united states the united states has perhaps the longest and most extensive set of controls over its bureaucracy and we thought it could serve as a template for measuring other executive branchesppthere are five basic mechanisms by which political principals control bureaucratic agents in the united states these mechanisms includepp1   em ex anteem procedural limitations on discretionary authoritypp2    emex postem reviewpp3    appointment and promotion powerpp4    removal power andpp5    emad hocem interventions by political authorities into bureaucratic decisionmaking including the use of emergency powersppin addition political principals control bureaucracies through their power over the budget but we regard this not as a separate mechanism but rather a component of each of the other five we can sketch each one briefly hereppstrongemex ante emprocedural controlsstrong the primary control over bureaucratic behavior was the landmark 1946 administrative procedure act which mandated that any new rule proposed by the bureaucracy be publicly posted and subject to noticeandcomment new rules would have to take these comments into account and could be contested emex postem through a system of administrative law judges aljs  in addition congress often mandates that agencies write detailed enabling legislation circumscribing their powers for example the 2010 doddfrank wall street reform and consumer protection act enjoined a series of regulatory agencies to write hundreds of new rules strengthening the federal oversight of financial institutions in the wake of the 2008 subprime crisisppstrongemex post emreviewstrong in addition to aljs there is a huge body of law surrounding emex postem judicial review under the heading of chevron deference this arose out of the 1984 supreme court decision emchevron usa inc v natural resources defense councilem created a twostep rule under which the court first decided whether the legislative statute clearly specified the nature of the delegated authority if the law was ambiguous or unclear the court would move to the second step if the agency judgment was considered a reasonable interpretation of the statute the court would defer to it the court moreover created a major questions doctrine exempting certain cases from the general rule conservative justices including clarence thomas and neil gorsuch have expressed reservations about the chevron framework arguing that it wrongly cedes judicial authority to the executive and violates separation of powers in its june 2022 ruling emwest virginia v environmental protection agencyem the supreme court expanded the scope of the major questions doctrine but left intact the chevron deference itself for the time beingppstrongappointment powerstrong article ii of the constitution endows presidents with executive power charges them to faithfully execute the laws and allows them to demand written opinions of high officials congress for its part is given the power to vest the appointment of inferior officials the definition of which is not clearly stated in some other part of governmentppdrawing on the latter provision a second major mechanism for limiting the presidents appointment power involves extensive rules for the hiring and promotion of lower level officials the most important such legislation was the 1883 pendleton act mentioned in my previous post which created the us civil service commission and mandated a system of meritbased hiring and promotionppstrongremoval powerstrong  the central fight being waged by conservatives today is over expansion of removal power that is the power of political principals to fire lower level officials they argue that the federal bureaucracy is filled with leftlearning democrats and that they cannot exercise political control unless they can purge themppwhile it might seem that a presidents powers to appoint and remove executive branch officials are equivalent they have never been treated as such since the founding of the republic the constitution specifies the presidents power to appoint high officials with the advice and consent of the senate yet is silent on removal the first congress engaged in a sophisticated debate over removal power ultimately granting that power to the president alone in something that came to be known as the decision of 1789 james madison and others argued that while senate refusal to approve a presidential appointment limited the chief executives power the president could always simply appoint another person the inability to remove a recalcitrant official by contrast constituted a much more significant limitation of executive powerppdiscretionary removal power came to be limited after world war ii with expansion of a federal employees ability to contest removal from office through an administrative or judicial process precedent for formal appeals of removals was set first for veterans then for the federal workforce more broadly removals became so procedurally difficult that many political principals avoided them thereby decreasing political control over bureaucratic behavior conservatives want to weaken those procedures and shift to atwill hiring and firingppstrongad hoc interventions and emergency powersstrong a final category of political control over bureaucracies concerns emad hocem interventions by political officials into the decisionmaking processes of bureaucracies these interventions can either be legal with all parties operating within their legislated mandates but violating established norms controlling their use or illegal andor unconstitutionalppwith regard to legal interventions the us constitution gives presidents certain extraordinary powers most notably as commanderinchief of the armed forces and pardon power former president donald trump made full use of these powers for example by pardoning former navy seal eddie gallagher who had been court martialed in a procedure strongly supported by the navy hierarchy while trump had a legal right to make this decision he violated a longstanding norm that deferred to the military hierarchy on issues of military justiceppin addition president trump sought to use illegal means to stay in office as president as detailed by the january 6 committeeppthe current attack by conservatives on the administrative state builds on the established framework of american administrative law  the two chief lines of criticism concern chevron deference which they argue unconstitutionally cedes too much power to the executive branch and removal power which is based on the pendleton act and is itself unconstitutional as it usurps the executives inherent powers i will deal with these two rather inconsistent lines of argument in next weeks postppppemimage an engine order telegraph flickra hrefhttpswwwflickrcomphotos20262161n003285783263inphotolist61mutzemvxtyixzjv5lid5l2yv42jsmsaj4s4kryavwfbqt5fucq2mmqdbudn7y4u4hk1d463kbna6jwhrzaa1wmiphwjd63jzw73crua3csrmphw264fzugn3crn63csnwhpdzve7z6vew2mxmqzc2hw6fk3atakabtjdhb2koxunq6k7vrxhpcexcpp3gvgbtknozq89unw2nsbqvp257fjmz2ntgro8cgzens2n869ev2krma38qw6eg72ijtzcw8jkwfp2mi8bjw2kp3kuw24rvj3t2mekxjp9bryge2kujc7nwicker_manaemp

img altvaluing deep state v controlling administrative state srchttpswwwamericanpurposecomcontentimages202210screenshot20221017at113537ampngpemfifth article series bureaucratic autonomy installment found hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea second hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea fourth hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartivwhydelegationisnecessaryhereaemppmany conservatives argue today americans living tyranny outofcontrol administrative state unelected bureaucrats allies courts critical decisions affecting lives fact number ways political principals control bureaucratic agents real problem different democratically elected legislators want government things issuing clear mandates fail use controls available bureaucrats left fill gaps own___steady_paywall___ppkate bersch davidson college written article emannual review political scienceem measure bureaucratic autonomy came hrefhttpscddrlfsistanfordedugovernancegovernance projecta leading stanford university 2011 sought come better measures state capacity wanted capture weberian aspects bureaucratic quality like autonomy meritocracy passed existing measures contributed survey instrument developed global survey public servants collaboration number academic institutionsppkate realized couldnt adequately measure bureaucratic autonomy didnt theory bureaucratic autonomy course writing article dove academic literature administrative law understand political principals control bureaucratic agents united states united states longest extensive set controls bureaucracy thought serve template measuring executive branchesppthere basic mechanisms political principals control bureaucratic agents united states mechanisms includepp1 em ex anteem procedural limitations discretionary authoritypp2 emex postem reviewpp3 appointment promotion powerpp4 removal power andpp5 emad hocem interventions political authorities bureaucratic decisionmaking including use emergency powersppin addition political principals control bureaucracies power budget regard separate mechanism component sketch briefly hereppstrongemex ante emprocedural controlsstrong primary control bureaucratic behavior landmark 1946 administrative procedure act mandated new rule proposed bureaucracy publicly posted subject noticeandcomment new rules comments account contested emex postem system administrative law judges aljs addition congress mandates agencies write detailed enabling legislation circumscribing powers example 2010 doddfrank wall street reform consumer protection act enjoined series regulatory agencies write hundreds new rules strengthening federal oversight financial institutions wake 2008 subprime crisisppstrongemex post emreviewstrong addition aljs huge body law surrounding emex postem judicial review heading chevron deference arose 1984 supreme court decision emchevron usa inc v natural resources defense councilem created twostep rule court decided legislative statute clearly specified nature delegated authority law ambiguous unclear court second step agency judgment considered reasonable interpretation statute court defer court created major questions doctrine exempting certain cases general rule conservative justices including clarence thomas neil gorsuch expressed reservations chevron framework arguing wrongly cedes judicial authority executive violates separation powers june 2022 ruling emwest virginia v environmental protection agencyem supreme court expanded scope major questions doctrine left intact chevron deference time beingppstrongappointment powerstrong article ii constitution endows presidents executive power charges faithfully execute laws allows demand written opinions high officials congress given power vest appointment inferior officials definition clearly stated governmentppdrawing provision second major mechanism limiting presidents appointment power involves extensive rules hiring promotion lower level officials important legislation 1883 pendleton act mentioned previous post created civil service commission mandated system meritbased hiring promotionppstrongremoval powerstrong central fight waged conservatives today expansion removal power power political principals fire lower level officials argue federal bureaucracy filled leftlearning democrats exercise political control purge themppwhile presidents powers appoint remove executive branch officials equivalent treated founding republic constitution specifies presidents power appoint high officials advice consent senate silent removal congress engaged sophisticated debate removal power ultimately granting power president came known decision 1789 james madison argued senate refusal approve presidential appointment limited chief executives power president simply appoint person inability remove recalcitrant official contrast constituted significant limitation executive powerppdiscretionary removal power came limited world war ii expansion federal employees ability contest removal office administrative judicial process precedent formal appeals removals set veterans federal workforce broadly removals procedurally difficult political principals avoided decreasing political control bureaucratic behavior conservatives want weaken procedures shift atwill hiring firingppstrongad hoc interventions emergency powersstrong final category political control bureaucracies concerns emad hocem interventions political officials decisionmaking processes bureaucracies interventions legal parties operating legislated mandates violating established norms controlling use illegal andor unconstitutionalppwith regard legal interventions constitution gives presidents certain extraordinary powers notably commanderinchief armed forces pardon power president donald trump use powers example pardoning navy seal eddie gallagher court martialed procedure strongly supported navy hierarchy trump legal right decision violated longstanding norm deferred military hierarchy issues military justiceppin addition president trump sought use illegal means stay office president detailed january 6 committeeppthe current attack conservatives administrative state builds established framework american administrative law chief lines criticism concern chevron deference argue unconstitutionally cedes power executive branch removal power based pendleton act unconstitutional usurps executives inherent powers deal inconsistent lines argument weeks postppppemimage engine order telegraph flickra hrefhttpswwwflickrcomphotos20262161n003285783263inphotolist61mutzemvxtyixzjv5lid5l2yv42jsmsaj4s4kryavwfbqt5fucq2mmqdbudn7y4u4hk1d463kbna6jwhrzaa1wmiphwjd63jzw73crua3csrmphw264fzugn3crn63csnwhpdzve7z6vew2mxmqzc2hw6fk3atakabtjdhb2koxunq6k7vrxhpcexcpp3gvgbtknozq89unw2nsbqvp257fjmz2ntgro8cgzens2n869ev2krma38qw6eg72ijtzcw8jkwfp2mi8bjw2kp3kuw24rvj3t2mekxjp9bryge2kujc7nwicker_manaemp

634dd9ae29d5126f5ad6503c

Bruno Latour and the philosophy of life

pas bruno latour confided to emle mondeem earlier this year in one of his final interviews a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagphilosophy target_blankphilosophya was his great intellectual love but across his long and immensely fertile intellectual life latour pursued that love by way of practically every other form of knowledge and pursuit sociology anthropology science history environmentalism political theory the visual arts theatre and fiction in this way he was above all a philosopher of life in the comprehensive german sense of emlebensphilosophieemp pemlebensphilosophieem whose leading exponents included figures such as friedrich nietzsche and martin heidegger enjoyed its intellectual heyday between the 1870s and the 1930s it was a project that sought to make sense of the dramatic development of modern science and the way it invaded every facet of life in the process it relentlessly questioned distinctions between the subject and knowledge and the foundations of metaphysics it spilled over into the sociology of a max weber or the marxism of a gyrgy lukcs in france writerthinkers such as charles pguy or henri bergson might be counted as advocates of the new philosophy their heirs were the existentialists of the 1940s and 1950s in the anglophone world one might think of the american pragmatists william james and john dewey the bloomsbury group and john maynard keynesp pa century later the project of a philosophy of life acquired new urgency for latour in an age of ecological crisis when it became crucial to understand ourselves not as freefloating knowing and producing subjects but as rooted or landed beings living alongside others with all the limits entanglements and potentials that entailedp pthe heretical positions on the status of scientific knowledge for which latour became notorious for some are best understood as attempts to place knowledge and truth claims back in the midst of life in a 2004 essay entitled how to talk about the body he imagined a dialogue between a knowing subject as imagined by a naive epistemology and a latourian subjectp pah sighs the traditional subject [as imagined by simplistic epistemologies] if only i could extract myself from this narrowminded body and roam through the cosmos unfettered by any instrument i would see the world as it is without words without models without controversies silent and contemplative really replies the articulated body [the latourian body which recognises its relationship to the world and knowledge about it as active and relational] with some benign surprise why do you wish to be dead for myself i want to be alive and thus i want more words more controversies more artificial settings more instruments so as to become sensitive to even more differences my kingdom for a more embodied bodyp pthe classical subjectobject distinction traps the knowing subject in a disembodied unworldly position that is in fact tantamount to death as latour wrote in a brilliant passage in the same essay on the training of noses the expert smelltesters who gauge perfume or tea or wine a direct and unmediated access to the primary qualities of odours could only be detected by a bodiless nose but what kind of image of knowledge is this [t]he opposite of embodied is dead not omniscientp pfor a burgundian latour was born in 1947 into a storied family of wine emngociantem in beaune this was an obvious but profound truth to really know something the way a good burgundian knows wine means not to float above the world but to be a porous part of it inhaling ingesting fermentation and the chemical elements of the emterroireem the irreducibly specific terrainp pfor latour claims to meaningful knowledge including scientific knowledge were generated not by simple rules and procedures that could be endlessly repeated with guaranteed results but through immersion in the world and its particularities this implied an existential engagement knowing interestingly is always a risky business he wrote which has to be started from scratch for any new proposition at hand what made for generative scientific discovery was not the tautological reproduction of a state of affairs by a true statement but the fecundity productivity richness originality of good articulations distinctions between true and false were more often than not banal only anxious epistemologists and methodologists of science worried about those what mattered to actual scientific practice was whether a claim was boring repetitive redundant inelegant simply accurate sterilep pif latour was a sceptic when it came to naive claims of detached scientific knowledge this also applied doubly to naive sociologies of knowledge critical analyses of power whether anticapitalist feminist or postcolonial were productive and inspiring but unless it was subject symmetrically to the same critique to which latour subjected naive claims to scientific knowledge social theory even that which proclaimed itself to be critical theory could all too easily become a snare if the relationship of life and knowledge was the problem then you could not cut through that gordian knot by invoking sociology to explain physics what was sociology after all but a form of organised social knowledge for better or for worse all you were doing in such an exercise was multiplying the articulations from one scientific discipline to another and not necessarily in a helpful or illuminating directionp pin refusing the inherited authority of the 19th and early 20thcentury canon of critical social science latour sought to create a form of knowledge more adequate to the late 20th and early 21st centuries latour thus belongs alongside michel foucault and gilles deleuze and flix guattari as one of the french thinkers who sought to escape the long shadow of marxism whether in its hegelian sartre or its antihegelian althusser varietiesp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomideas202210goldbankofenglanddollar target_blankas good as golda]emstrongp pin place of an overly substantive notion of the economy or society latour proposed the looser conception of actornetworks these are assemblages of tools resources researchers means of registering concepts and doing things that are not a priori defined in terms of a mode of production or a particular social order think of the lists of interconnected objects systems and agents that have held our attention in the past few years shipping containers the flow of rainwater in taiwan giant freighters stuck sideways in the suez canal driven off course by unpredictable currents and side winds each of these supply chain crises has exposed actornetworks of which we were previously oblivious during such moments we are forced to ask what is macro and what is micro what is base and what is superstructure these are latourian questionsp pone of the productive effects of seeing the world this way is that it becomes irresistibly obvious that all sorts of things have agency this realisation is disturbing because it seems to downgrade the privilege of actual human existence and the social relations between people but latours point was never to diminish the human but instead to emphasise the complex array of forces and agencies that are entailed in our modern lives our existence latour tried to show depends not on the simple structures that we imagined modernity to consist of markets states and so on but on the multiplication of what he calls hybrids supply chains in the widest sense of the wordp platour was not a class militant but that does not mean that he did not have a cause his lifelong campaign was for modernity to come to consciousness of itself to stop taking its own simplifications at face value to recognise the confusions and hybridity that it creates and endlessly feeds off his mission was to persuade us as the title of his most widely read book has it that emwe have never been modernem 1991 the confusion of a world in which lipid bubbles aerosols and face masks have occupied our minds for years is what latour wanted to prepare us forp pwhat latour sought to expose was the pervasive animism that surrounds us in the form of hybrid actornetworks whose force and significance we consistently deny a relnoreferrer noopener nofollow hrefhttpwwwbrunolatourfrsitesdefaultfilesuploads0911frankeanimismpdf target_blankhybrids are everywherea he said but the question is how do you tame them or do you explicitly recognise their strengths which is part of the animist power of objects what latour diagnosed is that modernity as part of its productive logic systematically denies this animation of the material world modernism is the mode of life that finds the soul with which matter would be endowed the animation shockingp pthis repression of hybrid animated material reality is exposed in the oftenracialised embarrassment of those who believe themselves modern when they encounter human civilisations that make no secret of their animist beliefs it also accounts for the embarrassment triggered among true believers in modern science and its ideology by the revelations of the best histories of science such as those by simon schaffer to whom latour owed a great debt to latours delight schaffer showed how isaac newton in the first instance saw in gravity the manifestation of the power of angelsp pthe modernist impulse is to dismiss such ideas as hangovers of an earlier religious worldview and to relegate african art to the anthropology museum but at the risk of provocation and scandal latours response was the opposite rather than finishing the purification of modernity and expunging angels and animism from our view of the forces that move the world he urged that we should open our ontology to encompass the giant dark matter of hybrid concepts and real networks that actually sustain modern lifep pfrom the 1990s onwards this made latour one of the foremost thinkers in the ecological movement and once again he reached for the most radical and encompassing animist notion with which to frame that commitment the gaia concept which postulates the existence of a single overarching living being encompassing global ecology this is an eerie supernatural nonmodern idea but for latour if we settle for any more mundane description of the ecological crisis if we fit the environment into preexisting costbenefit models as economists often do we fail to recognise the radicalism of the forces that we have unleashed we fail to understand the peril that we are in that gaia will lose patience and toss us snarling off her backp platours emphatic embrace of life plenitude and articulation did not mean that he shrank from finitude or death rather the opposite it is only from a thoroughly immanent view that you truly feel the weight of life lived towards its end and the mysterious and awesome finality that is death it is only from an embrace of life as emphatic as latours that you truly register the encroachment of deadening forces of the mind and the body for latour life and death were intertwined by the effort of those left behind to make sense of death by every means at their disposal sometimes at very long distancep pin september 1976 the body of ramesses ii the third pharaoh of the 19th dynasty of egypt was flown to paris he was welcomed with the full military honours appropriate for a great ruler and then his body was whisked to the laboratory to be subject to medicalforensic examination for latour this fantastic juxtaposition of the ancient and the modern was an irresistible provocation the naive position was that the scientists discovered that ramesses died of tuberculosis 3000 years ago he was also a racially minded police forensic scientist claimed most likely a redhead for latour the question was more basic how can we debate claims made selfconfidently about a death that took place thousands of years ago we were not there there was no modern medical science then when ramesses ceased to live tb was not even a thing it was not until 1882 that robert koch in berlin identified the bacillus and even then no one could have made any sensible claim about ramesses making the naive apparently matteroffact claim that ramesses died of tb in 1213 bc in fact involves giant leaps of the imaginationp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomcultureartdesign202210thecezanneconundrum target_blankthe czanne conundruma]emstrongp pwhat we do know and can debate are what latour would call articulations we know that as a result of the intervention of the french president valry giscard destaing the egyptian authorities were prevailed upon to allow the decaying mummy to be flown to paris for preservation we know that in paris what was left of the body was enrolled in modern technoscientific systems and testing procedures leading us to venture hypotheses about the cause of death in the distant past every single one of those articulations can be tested probed and thereby multiplied entire bodies of thought can be built on different hypotheses about the corpse so latour maintained rather than those who assertively claim to know what actually happened 3000 years ago the journalist who declared vertiginously that ramesses had finally died of tb in 1976 came closer to the truth in registering both the gulf that separates us from an event millennia in the past and the radical historical immanence of our current diagnosis in his effort to shake us out of the complacent framework of certainty that modernity had created around us counterintuitive provocations of this kind were part of latours methodp punlike ramesses cause of death bruno latours was well mapped in the 21st century a cancer diagnosis has immediate and drastic implications it enrols you as a patient in the machinery of the medicalindustrial complex among all the hybrids that modern societies have created the medical apparatus is one of the most complex it grows ever larger and imposes its urgency in a relentless and merciless fashion if you take your critical vantage point from an early 20thcentury theorist of alienation like lukcs or weber for instance it is tempting to think of this technoscientific medical apparatus as a steelhard cage that relentlessly objectifies its patients as bodies and cases but for latour this again falls into a modernist trap to start from the premise that objectification is actually achieved is to misunderstand and to grant too much reductionism is not a sin for which scientists should make amends but a dream precisely as unreachable as being alive and having no body even the hospital is not able to reduce the patient to a mere objectp prather than reducing us modern medicalisation multiplies us when you enter into contact with hospitals your rich subjective personality is not reduced to a mere package of objective meat on the contrary you are now learning to be affected by masses of agencies hitherto unknown not only to you but also to doctors nurses administration biologists researchers who add to your poor inarticulate body complete sets of new instruments the body becomes a site of a profuse multiplicity how can you contain so much diversity so many cells so many microbes so many organs all folded in such a way that the many act as one as [alfred north] whitehead said no subjectivity no introspection no native feeling can be any match for the fabulous proliferation of affects and effects that a body learns when being processed by a hospital far from being less you become morep pits a brave image perhaps it was one that sustained latour as the cancer and the agencies deployed to fight it laid waste to his flesh not for nothing people describe the illness as a battle like a war it can go on for yearsp platour liked military images perhaps because they better captured his vision of history as mysterious opaque complex and contingent military history is one area of the modern world in which even the most highminded analysts end up talking about tanks bridges rivers himars javelins and the fog of war in the end it is often for want of nails that battles are lost the original french title of latours famous book on the 19thcentury french microbiologist louis pasteur empasteur guerre et paix des microbes suivi de irrductionsem paid homage to tolstoy in the english translation that reference was lost emthe pasteurization of franceem 1988 replaces the frenchs titles nod to emwar and peaceem with ugly sociologesep platours own life force was strong in his apartment on rue danton paris with the charred remains of notre dames in background he shared wines with visitors from around the world from vineyards planted in response to climate change covid lockdowns left him impatient as soon as global traffic resumed in 2021 he was assisting in the curation of the taipei biennial latours final book emafter lockdown a metamorphosisem appeared in english in 2021 it carries his voice into the present inviting us to imagine ourselves in an inversion of kafkas fable as happy termites emerging from the lockdown on six hairy legs with your antennae your articulations your emanations your waste matter your mandibles your prostheses you may at last be becoming a human being no longer ill at ease nothing is alien to you anymore youre no longer alone you quietly digest a few molecules of whatever reaches your intestines after having passed through the metabolism of hundreds of millions of relatives allies compatriots and competitorsp pas he aged latour became more not less radical often dismissed on the left for his scepticism about classical critical social theory the ecological turn made latour into nothing less than an ecowarrior his cause was the overturning of the dream world that systematically failed to recognise or grasp the forces unleashed by the modernist apparatus of production and cognition we needed to come down to earth to land only then could we begin the hard work with other actors of arriving at a sustainable modus vivendi the urgency was that of war and his mobilisation was total the range of projects that he spawned in recent decades artistic political intellectual was dizzying all of them aimed to find new political forms new parliaments new articulationsp punlike many commentators and politicians in response to populism and specifically the emgilet jaunesem protests of 2018 latour did not retreat to higher levels of technocracy but instigated a collective project to compile emcahiers de dolanceem books of complaint like those assembled before the french revolution of 1789 the aim was to enrol people from all walks of life in defining what they need to live and what threatened their livelihoodp ppart of the project involved an a relnoreferrer noopener nofollow hrefhttpsfrenchcultureorgevents12403wherelandafterpandemicatlanta target_blankinteractive theatrical exercisea enacted by latour with the architect and performanceart impresario soheil hajmirbaba in a kind of ritual game the participants arranged themselves and the forces enabling and threatening their lives ranging from sea level rise to the increased prices for diesel on a circular stage marked out with a compass it was as latour described it like a childrens game lighthearted and a lot of fun and yet when you get near the middle everyone gets a bit nervous the centre of the crucible where i timidly put my feet is the exact intersection of a trajectory and im not in the habit of thinking of myself as a vector of a trajectory which goes from the past all that ive benefited from so as to exist to grow sometimes without even realising it on which i unconsciously count and which may well stop with me through my fault which wont go towards the future anymore because of all that threatens my conditions of existence of which i was also unawarep pthe amazing result of this little enactment he continued is that youre soon surrounded by a small assembly which nonetheless represents your most personal situation in front of the other participants the more attachments you list the more clearly you are defined the more precise the description the more the stage fills up a woman in the group sums it up in one phrase im repopulatedp pthus latour reinvented the role of the engaged french intellectual for the 21st century and in doing so he forced the followon question was he perhaps the last of his kind who comes after him as far as intellectual standing is concerned latour would have been impatient with the question he was too preoccupied with new problems and projects too enthused by the networks of collaborators young and old whose work he drew on and that he helped to energise but in a more general sense the question of succession haunted him that after all is the most basic issue posed by the ecological crisis what comes after us what is our responsibility to the continuity of lifep pin his effort to enact the motion of coming down to earth latour faced the question head on with my feet on the consortiums compass i consult myself in terms of my minuscule actions do i enhance or do i stifle the lives of those ive benefited from till now asking that question never content with complacent or selfsatisfied answers during the night of 89 october 2022 bruno latour died aged 75 in paris of pancreatic cancerp pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomuncategorized202210justicelodestarnewsocietydylanrileyinterviewtrump target_blankjustice cannot be the lodestar of a new societya]emstrongp

pas bruno latour confided emle mondeem earlier year final interviews relnoreferrer noopener hrefhttpswwwnewstatesmancomtagphilosophy target_blankphilosophya great intellectual love long immensely fertile intellectual life latour pursued love way practically form knowledge pursuit sociology anthropology science history environmentalism political theory visual arts theatre fiction way philosopher life comprehensive german sense emlebensphilosophieemp pemlebensphilosophieem leading exponents included figures friedrich nietzsche martin heidegger enjoyed intellectual heyday 1870s 1930s project sought sense dramatic development modern science way invaded facet life process relentlessly questioned distinctions subject knowledge foundations metaphysics spilled sociology max weber marxism gyrgy lukcs france writerthinkers charles pguy henri bergson counted advocates new philosophy heirs existentialists 1940s 1950s anglophone world think american pragmatists william james john dewey bloomsbury group john maynard keynesp pa century later project philosophy life acquired new urgency latour age ecological crisis crucial understand freefloating knowing producing subjects rooted landed beings living alongside limits entanglements potentials entailedp pthe heretical positions status scientific knowledge latour notorious best understood attempts place knowledge truth claims midst life 2004 essay entitled talk body imagined dialogue knowing subject imagined naive epistemology latourian subjectp pah sighs traditional subject [as imagined simplistic epistemologies] extract narrowminded body roam cosmos unfettered instrument world words models controversies silent contemplative replies articulated body [the latourian body recognises relationship world knowledge active relational] benign surprise wish dead want alive want words controversies artificial settings instruments sensitive differences kingdom embodied bodyp pthe classical subjectobject distinction traps knowing subject disembodied unworldly position fact tantamount death latour wrote brilliant passage essay training noses expert smelltesters gauge perfume tea wine direct unmediated access primary qualities odours detected bodiless nose kind image knowledge [t]he opposite embodied dead omniscientp pfor burgundian latour born 1947 storied family wine emngociantem beaune obvious profound truth know way good burgundian knows wine means float world porous inhaling ingesting fermentation chemical elements emterroireem irreducibly specific terrainp pfor latour claims meaningful knowledge including scientific knowledge generated simple rules procedures endlessly repeated guaranteed results immersion world particularities implied existential engagement knowing interestingly risky business wrote started scratch new proposition hand generative scientific discovery tautological reproduction state affairs true statement fecundity productivity richness originality good articulations distinctions true false banal anxious epistemologists methodologists science worried mattered actual scientific practice claim boring repetitive redundant inelegant simply accurate sterilep pif latour sceptic came naive claims detached scientific knowledge applied doubly naive sociologies knowledge critical analyses power anticapitalist feminist postcolonial productive inspiring subject symmetrically critique latour subjected naive claims scientific knowledge social theory proclaimed critical theory easily snare relationship life knowledge problem cut gordian knot invoking sociology explain physics sociology form organised social knowledge better worse exercise multiplying articulations scientific discipline necessarily helpful illuminating directionp pin refusing inherited authority 19th early 20thcentury canon critical social science latour sought create form knowledge adequate late 20th early 21st centuries latour belongs alongside michel foucault gilles deleuze flixguattari french thinkers sought escape long shadow marxism hegelian sartre antihegelian althusser varietiesp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomideas202210goldbankofenglanddollar target_blankas good golda]emstrongp pin place overly substantive notion economy society latour proposed looser conception actornetworks assemblages tools resources researchers means registering concepts things priori defined terms mode production particular social order think lists interconnected objects systems agents held attention past years shipping containers flow rainwater taiwan giant freighters stuck sideways suez canal driven course unpredictable currents winds supply chain crises exposed actornetworks previously oblivious moments forced ask macro micro base superstructure latourian questionsp pone productive effects seeing world way irresistibly obvious sorts things agency realisation disturbing downgrade privilege actual human existence social relations people latours point diminish human instead emphasise complex array forces agencies entailed modern lives existence latour tried depends simple structures imagined modernity consist markets states multiplication calls hybrids supply chains widest sense wordp platour class militant mean cause lifelong campaign modernity come consciousness stop taking simplifications face value recognise confusions hybridity creates endlessly feeds mission persuade title widely read book emwe modernem 1991 confusion world lipid bubbles aerosols face masks occupied minds years latour wanted prepare forp pwhat latour sought expose pervasive animism surrounds form hybrid actornetworks force significance consistently deny relnoreferrer noopener nofollow hrefhttpwwwbrunolatourfrsitesdefaultfilesuploads0911frankeanimismpdf target_blankhybrids everywherea said question tame explicitly recognise strengths animist power objects latour diagnosed modernity productive logic systematically denies animation material world modernism mode life finds soul matter endowed animation shockingp pthis repression hybrid animated material reality exposed oftenracialised embarrassment believe modern encounter human civilisations secret animist beliefs accounts embarrassment triggered true believers modern science ideology revelations best histories science simon schaffer latour owed great debt latours delight schaffer showed isaac newton instance saw gravity manifestation power angelsp pthe modernist impulse dismiss ideas hangovers earlier religious worldview relegate african art anthropology museum risk provocation scandal latours response opposite finishing purification modernity expunging angels animism view forces world urged open ontology encompass giant dark matter hybrid concepts real networks actually sustain modern lifep pfrom 1990s onwards latour foremost thinkers ecological movement reached radical encompassing animist notion frame commitment gaia concept postulates existence single overarching living encompassing global ecology eerie supernatural nonmodern idea latour settle mundane description ecological crisis fit environment preexisting costbenefit models economists fail recognise radicalism forces unleashed fail understand peril gaia lose patience toss snarling backp platours emphatic embrace life plenitude articulation mean shrank finitude death opposite thoroughly immanent view truly feel weight life lived end mysterious awesome finality death embrace life emphatic latours truly register encroachment deadening forces mind body latour life death intertwined effort left sense death means disposal long distancep pin september 1976 body ramesses ii pharaoh 19th dynasty egypt flown paris welcomed military honours appropriate great ruler body whisked laboratory subject medicalforensic examination latour fantastic juxtaposition ancient modern irresistible provocation naive position scientists discovered ramesses died tuberculosis 3000 years ago racially minded police forensic scientist claimed likely redhead latour question basic debate claims selfconfidently death took place thousands years ago modern medical science ramesses ceased live tb thing 1882 robert koch berlin identified bacillus sensible claim ramesses making naive apparently matteroffact claim ramesses died tb 1213 bc fact involves giant leaps imaginationp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomcultureartdesign202210thecezanneconundrum target_blankthe czanne conundruma]emstrongp pwhat know debate latour articulations know result intervention french president valry giscard destaing egyptian authorities prevailed allow decaying mummy flown paris preservation know paris left body enrolled modern technoscientific systems testing procedures leading venture hypotheses cause death distant past single articulations tested probed multiplied entire bodies thought built different hypotheses corpse latour maintained assertively claim know actually happened 3000 years ago journalist declared vertiginously ramesses finally died tb 1976 came closer truth registering gulf separates event millennia past radical historical immanence current diagnosis effort shake complacent framework certainty modernity created counterintuitive provocations kind latours methodp punlike ramesses cause death bruno latours mapped 21st century cancer diagnosis immediate drastic implications enrols patient machinery medicalindustrial complex hybrids modern societies created medical apparatus complex grows larger imposes urgency relentless merciless fashion critical vantage point early 20thcentury theorist alienation like lukcsor weber instance tempting think technoscientific medical apparatus steelhard cage relentlessly objectifies patients bodies cases latour falls modernist trap start premise objectification actually achieved misunderstand grant reductionism sin scientists amends dream precisely unreachable alive having body hospital able reduce patient mere objectp prather reducing modern medicalisation multiplies enter contact hospitals rich subjective personality reduced mere package objective meat contrary learning affected masses agencies hitherto unknown doctors nurses administration biologists researchers add poor inarticulate body complete sets new instruments body site profuse multiplicity contain diversity cells microbes organs folded way act [alfred north] whitehead said subjectivity introspection native feeling match fabulous proliferation affects effects body learns processed hospital far morep pits brave image sustained latour cancer agencies deployed fight laid waste flesh people describe illness battle like war yearsp platour liked military images better captured vision history mysterious opaque complex contingent military history area modern world highminded analysts end talking tanks bridges rivers himars javelins fog war end want nails battles lost original french title latours famous book 19thcentury french microbiologist louis pasteur empasteur guerre et paix des microbes suivi de irrductionsem paid homage tolstoy english translation reference lost emthe pasteurization franceem 1988 replaces frenchs titles nod emwar peaceem ugly sociologesep platours life force strong apartment rue danton paris charred remains notre dames background shared wines visitors world vineyards planted response climate change covid lockdowns left impatient soon global traffic resumed 2021 assisting curation taipei biennial latours final book emafter lockdown metamorphosisem appeared english 2021 carries voice present inviting imagine inversion kafkas fable happy termites emerging lockdown hairy legs antennae articulations emanations waste matter mandibles prostheses human longer ill ease alien anymore youre longer quietly digest molecules reaches intestines having passed metabolism hundreds millions relatives allies compatriots competitorsp pas aged latour radical dismissed left scepticism classical critical social theory ecological turn latour ecowarrior cause overturning dream world systematically failed recognise grasp forces unleashed modernist apparatus production cognition needed come earth land begin hard work actors arriving sustainable modus vivendi urgency war mobilisation total range projects spawned recent decades artistic political intellectual dizzying aimed find new political forms new parliaments new articulationsp punlike commentators politicians response populism specifically emgilet jaunesem protests 2018 latour retreat higher levels technocracy instigated collective project compile emcahiers de dolanceem books complaint like assembled french revolution 1789 aim enrol people walks life defining need live threatened livelihoodp ppart project involved relnoreferrer noopener nofollow hrefhttpsfrenchcultureorgevents12403wherelandafterpandemicatlanta target_blankinteractive theatrical exercisea enacted latour architect performanceart impresario soheil hajmirbaba kind ritual game participants arranged forces enabling threatening lives ranging sea level rise increased prices diesel circular stage marked compass latour described like childrens game lighthearted lot fun near middle gets bit nervous centre crucible timidly feet exact intersection trajectory im habit thinking vector trajectory goes past ive benefited exist grow realising unconsciously count stop fault wont future anymore threatens conditions existence unawarep pthe amazing result little enactment continued youre soon surrounded small assembly nonetheless represents personal situation participants attachments list clearly defined precise description stage fills woman group sums phrase im repopulatedp pthus latour reinvented role engaged french intellectual 21st century forced followon question kind comes far intellectual standing concerned latour impatient question preoccupied new problems projects enthused networks collaborators young old work drew helped energise general sense question succession haunted basic issue posed ecological crisis comes responsibility continuity lifep pin effort enact motion coming earth latour faced question head feet consortiums compass consult terms minuscule actions enhance stifle lives ive benefited till asking question content complacent selfsatisfied answers night 89 october 2022 bruno latour died aged 75 paris pancreatic cancerp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomuncategorized202210justicelodestarnewsocietydylanrileyinterviewtrump target_blankjustice lodestar new societya]emstrongp

634f29ba8ff7051128adf94c

YA star John Green seeks co-authors for climate story that averts disaster

pbestselling author john green told a true story of recklessness and suffering friday as a way of urging his harvard audience to rise to the the biggest shared challenge facing the human species climate changep pgreen who rose to fame with the 2012 publication of his young adult novel the fault in our stars a moving tale of two teenage cancer patients who fall in love is a social media star with millions of followers on tiktok instagram and youtube a long line of fans snaked across the yard outside memorial church before the doors openedp pthe rev matthew ichihashi potts pusey minister in the memorial church and plummer professor of christian morals in the faculty of divinity introduced green by highlighting his work as a writer public thinker and philanthropist the author supports numerous charities and serves on the board of trustees of a hrefhttpswwwpihorgpartners in healthap pin a talk titled how the world ends the first of the william belden noble lecture series which will examine moral and ethical questions surrounding climate change green lamented the state of the world and humans role in the crisisp pone of the great ironies of humans worrying so much about our apocalypse is that we often forget that for many species we are the apocalypse said green were not the first species to become so powerful on earth that we muck up the climate and threaten the planets biodiversity by altering its atmosphere but were the first species to know what were doing while we do it were the first catastrophic life form to understand that we are catastrophicp pbut climate change is not the only threat to the planet green noted poverty is not natural or inevitable he said he bemoaned the 4 million children who will die this year before reaching age 5 due to povertyrelated diseases such as diarrhea malaria and tuberculosis and the heightened vulnerability of poor people to globalwarmingrelated natural disastersp pi dont believe climate change will herald the end of the world but in a way if we dont respond aggressively to the challenge while simultaneously building more just and inclusive systems i think whats coming could be worse than a mere apocalypse said green whose talk was interrupted several times by applausep pa graduate of kenyon college green spent six months as a student chaplain at a childrens hospital an experience that helped shape the fault in our stars he said he takes inspiration from jesus teachings and commitment to the poor his work he said is driven by hope he encouraged the audience to find ways to change the worldp pi do not need to tell the many of you in this sanctuary working to bring about a more just world through activism education and solidarity that such work is messy and complex and full of frustrations and heartbreaks and too often incremental change but that is truly so far as i understand it the lords work and for me anyway a path the only path ive found to encountering the divine he saidp pasked how to respond to the fear of living in a world on the brink of collapse green urged the audience to resist being consumed by apocalyptic anxietyp pits very easy to be paralyzed by fear he said its important to be afraid but also important is not to despair i cannot imagine what it is like for you all to live through this difficult period of human history as young people but even so i think despair never tells the full human historyp

pbestselling author john green told true story recklessness suffering friday way urging harvard audience rise biggest shared challenge facing human species climate changep pgreen rose fame 2012 publication young adult novel fault stars moving tale teenage cancer patients fall love social media star millions followers tiktok instagram youtube long line fans snaked yard outside memorial church doors openedp pthe rev matthew ichihashi potts pusey minister memorial church plummer professor christian morals faculty divinity introduced green highlighting work writer public thinker philanthropist author supports numerous charities serves board trustees hrefhttpswwwpihorgpartners healthap pin talk titled world ends william belden noble lecture series examine moral ethical questions surrounding climate change green lamented state world humans role crisisp pone great ironies humans worrying apocalypse forget species apocalypse said green species powerful earth muck climate threaten planets biodiversity altering atmosphere species know catastrophic life form understand catastrophicp pbut climate change threat planet green noted poverty natural inevitable said bemoaned 4 million children die year reaching age 5 povertyrelated diseases diarrhea malaria tuberculosis heightened vulnerability poor people globalwarmingrelated natural disastersp pi dont believe climate change herald end world way dont respond aggressively challenge simultaneously building inclusive systems think whats coming worse mere apocalypse said green talk interrupted times applausep pa graduate kenyon college green spent months student chaplain childrens hospital experience helped shape fault stars said takes inspiration jesus teachings commitment poor work said driven hope encouraged audience find ways change worldp pi need tell sanctuary working bring world activism education solidarity work messy complex frustrations heartbreaks incremental change truly far understand lords work path path ive found encountering divine saidp pasked respond fear living world brink collapse green urged audience resist consumed apocalyptic anxietyp pits easy paralyzed fear said important afraid important despair imagine like live difficult period human history young people think despair tells human historyp

634f29e48ff7051128adf94e

Some Thoughts on Moving Beyond ‘Neoliberal Globalization’

pif i had started reading the recent column by financial times columnist a relnoreferrer noopener hrefhttpswwwftcomranaforoohar target_blankrana foroohara a relnoreferrer noopener hrefhttpswwwftcomcontentc8d550f9c7c14eefa6cc3db3af298f1b target_blankfree trade has not made us freea in the middle of the piece i would have first come across this sentence our system of neoliberal globalization has created more wealth at a global scale over the past halfcentury than ever before and based solely on that powerfuland accurateassertion i might have assumed the column was a stirring defense of neoliberal globalization and how supporters need to push back against those who would undermine it p pbut as the columns headline suggests i would have been wrong foroohar nestles that almost concessionaryalmost boilerplate reallysentence inside a broader argument that suggests a need to move beyond neoliberal globalization due to the huge growth in inequality within many countries well that and the new need to friendshore supply chains to strategic allies also climate change is in there too forooharp blockquote classwpblockquotepthe point here is that the current system of economic globalization isnt going to magically dissolve political differences we are heading towards a new postneoliberal paradigm in which values rather than just everyday low prices as the walmart retail slogan goes become a more important consideration in economic policy decisionspblockquote pa few pointsp pfirst lets not downplay that bit about wealth at a global scale while that phrase might make you think of apple shareholders i think of this wondrous fact from a relnoreferrer noopener hrefhttpsourworldindataorgpovertyinsightglobalextremepovertydeclinedsubstantiallyoverthelastgenerationkeyinsightsonpoverty target_blankour world in dataa there are more than a billion fewer people living below the international poverty line of 215 per day today than in 1990 on average the number declined by 47 million every year or 130000 people each dayp psecond lets be parochial how have american workers been doing since 1990 analysis by my aei colleague michael strainwhich can be found in his 2020 book a relnoreferrer noopener hrefhttpswwwamazoncomamericandreamnotdeadpopulismdp159947557xrefsr_1_1dchild1qid1600698589refinementsp_273amichaelrstrainsbookssr11 target_blankemthe american dream is not dead but populism could kill itemafinds that over the past three decades wages for typical workers have grown by 20 percent using the cpi and using the pcethe better measure of inflationfinds a onethird increase in wages and with stronger productivity growth wage growth might well have been even strongerp pthird while foroohar might hope that this new postliberal paradigm will mean a greater commitment to values including human rights and commitments to climate change i would note that the rightwing populists who are also pushing for a new paradigm care nothing about those values be careful what you wish for populists want iphones made in cupertino not bangalorep pfourth about this friendshoring thing i would refer to an excellent a relnoreferrer noopener hrefhttpswwwftcomcontentd8a0ce5edc8b4bce8dbfc09d08d263a5 target_blankpiece aby ft columnist alan beattie heres one of many strong pointsp blockquote classwpblockquotep the tools authorities have to refashion supply chains along strategic lines are clumsy and expensive on the export side governments can restrict sales of sensitive technology as the us and eu have done over semiconductors and other products for russia and china but with imports companies will go for cheap inputs and it will take serious fiscal or regulatory effort to make them shift suppliers on a large scale that has implications for public finances or product prices or bothpblockquote pfifth markets work as cato institute trade scholar a relnoreferrer noopener hrefhttpswwwwsjcomarticlesshouldtheusgovernmentsubsidizedomesticchipproduction11645827450 target_blankhas pointed outa many large chipconsuming companies are already adjusting their supply chains to account for geopolitical tensions and incentivedriven market moves are going to be a lot more effective than government mandatesp pfinally many globalization skeptics are still stuck in china trade shock mode so let me highlight this 2017 a hrefhttpswwwaeiorgeconomicswevehadthechinatradeshockwhatnowaqawithgordonhansonpodcast chata i had with gordon hanson one of the author along with david autor and david dorn of the paper a relnoreferrer noopener hrefhttpwwwddornnetpapersautordornhansonchinashockpdf target_blankthe china shocka hansonp blockquote classwpblockquotepif you wanted to say that trade with china has been bad for workers in southern ohio parts of tennessee and north carolina parts of pennsylvania that would be hard to argue with but you cant go from that conclusion to say trades been bad for the united states as a whole  and so if we want to embrace globalization weve got to make sure that weve got the policies in place that help workers who are the losers from expanded international trade and i think what weve learned after the fact and what weve learned from many folks perspective too late is that we have a counter set of policies in place when it comes to helping labor markets adjust so on the trade agreement side thats not where the failings were the failings were that we didnt appreciate the importance that china was going to mean for a relatively small number of places in the united states that were directly in line of competition with lowwage economies in the rest of the worldpblockquote divpstronglearn more stronga hrefhttpswwwaeiorgeconomicsafewthoughtsaboutcapitalismandinequalitystronga few thoughts about capitalism and inequality stronga a hrefhttpswwwaeiorgpethokoukismoreonthetradeoffsofrejectingnuclearenergymore on the tradeoffs of rejecting nuclear energya a hrefhttpswwwaeiorgeconomicshousingpricesandelectionshousing prices and electionsa a hrefhttpswwwaeiorgeconomicsthinkaboutstudentloanreformsratherthanforgivenessthink about student loan reforms rather than forgivenessapdiv pthe post a relnofollow hrefhttpswwwaeiorgeconomicssomethoughtsonmovingbeyondneoliberalglobalizationsome thoughts on moving beyond neoliberal globalizationa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap

pif started reading recent column financial times columnist relnoreferrer noopener hrefhttpswwwftcomranaforoohar target_blankrana foroohara relnoreferrer noopener hrefhttpswwwftcomcontentc8d550f9c7c14eefa6cc3db3af298f1b target_blankfree trade freea middle piece come sentence system neoliberal globalization created wealth global scale past halfcentury based solely powerfuland accurateassertion assumed column stirring defense neoliberal globalization supporters need push undermine itp pbut columns headline suggests wrong foroohar nestles concessionaryalmost boilerplate reallysentence inside broader argument suggests need neoliberal globalization huge growth inequality countries new need friendshore supply chains strategic allies climate change forooharp blockquote classwpblockquotepthe point current system economic globalization isnt going magically dissolve political differences heading new postneoliberal paradigm values everyday low prices walmart retail slogan goes important consideration economic policy decisionspblockquote pa pointsp pfirst lets downplay bit wealth global scale phrase think apple shareholders think wondrous fact relnoreferrer noopener hrefhttpsourworldindataorgpovertyinsightglobalextremepovertydeclinedsubstantiallyoverthelastgenerationkeyinsightsonpoverty target_blankour world dataa billion fewer people living international poverty line 215 day today 1990 average number declined 47 million year 130000 people dayp psecond lets parochial american workers 1990 analysis aei colleague michael strainwhich found 2020 book relnoreferrer noopener hrefhttpswwwamazoncomamericandreamnotdeadpopulismdp159947557xrefsr_1_1dchild1qid1600698589refinementsp_273amichaelrstrainsbookssr11 target_blankemthe american dream dead populism kill itemafinds past decades wages typical workers grown 20 percent cpi pcethe better measure inflationfinds onethird increase wages stronger productivity growth wage growth strongerp pthird foroohar hope new postliberal paradigm mean greater commitment values including human rights commitments climate change note rightwing populists pushing new paradigm care values careful wish populists want iphones cupertino bangalorep pfourth friendshoring thing refer excellent relnoreferrer noopener hrefhttpswwwftcomcontentd8a0ce5edc8b4bce8dbfc09d08d263a5 target_blankpiece aby ft columnist alan beattie heres strong pointsp blockquote classwpblockquotep tools authorities refashion supply chains strategic lines clumsy expensive export governments restrict sales sensitive technology eu semiconductors products russia china imports companies cheap inputs fiscal regulatory effort shift suppliers large scale implications public finances product prices bothpblockquote pfifthmarkets work cato institute trade scholar relnoreferrer noopener hrefhttpswwwwsjcomarticlesshouldtheusgovernmentsubsidizedomesticchipproduction11645827450 target_blankhas pointed outa large chipconsuming companies adjusting supply chains account geopolitical tensions incentivedriven market moves going lot effective government mandatesp pfinally globalization skeptics stuck china trade shock mode let highlight 2017 hrefhttpswwwaeiorgeconomicswevehadthechinatradeshockwhatnowaqawithgordonhansonpodcast chata gordon hanson author david autor david dorn ofthe paper relnoreferrer noopener hrefhttpwwwddornnetpapersautordornhansonchinashockpdf target_blankthe china shocka hansonp blockquote classwpblockquotepif wanted trade china bad workers southern ohio parts tennessee north carolina parts pennsylvania hard argue cant conclusion trades bad united states want embrace globalization weve got sure weve got policies place help workers losers expanded international trade think weve learned fact weve learned folks perspective late counter set policies place comes helping labor markets adjust trade agreement thats failings failings didnt appreciate importance china going mean relatively small number places united states directly line competition lowwage economies rest worldpblockquote divpstronglearn stronga hrefhttpswwwaeiorgeconomicsafewthoughtsaboutcapitalismandinequalitystronga thoughts capitalism inequalitystronga hrefhttpswwwaeiorgpethokoukismoreonthetradeoffsofrejectingnuclearenergymore tradeoffs rejecting nuclear energya hrefhttpswwwaeiorgeconomicshousingpricesandelectionshousing prices electionsa hrefhttpswwwaeiorgeconomicsthinkaboutstudentloanreformsratherthanforgivenessthink student loan reforms forgivenessapdiv pthe post relnofollow hrefhttpswwwaeiorgeconomicssomethoughtsonmovingbeyondneoliberalglobalizationsome thoughts moving neoliberal globalizationa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap

634f29fa8ff7051128adf954

A North Carolina Man Was Jailed for Refusing To Wear a Mask in Court

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_1792127342400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_1792127341200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_179212734600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_179212734331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_1792127342400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_1792127341200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_179212734600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_179212734331x186jpg 331w img width1200 altface mask srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpg height675 picture div pspana north carolina man wasspan a hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spanjailedspanaspan for 24 hours for contempt of court last week his offense refusing to wear a mask in courtspanp pspanon october 10spanspan gregory hahn arrived at a harnett county north carolina courthouse to report for jury duty there were no local mask ordinances in place and no mask mandate at the courthouse spanp pspanquotthere were signs saying no masks were requiredquot hahn later toldspan a hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spanwralspana a local news stationp pspanhowever judge charles gilchrist had his own rules after arriving hahn and the other 98 potential jurors were informed that masks would be required in judge gilchrists courtroom quotyou can go in any district courtroom without a mask you can come into superior clerk court without a mask and the [district attorneys] office without a mask but with judge gilchrist he has a mandate that you must wear a maskquot clerk of superior court renee whittentonspan a hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spantoldspanaspan wral adding that of the superior court judges in the county gilchrist is the only one with a mask mandatespanp pspanwhen hahn refused to mask he found himself behind barsspandel delp pspanwhile judges have wide latitude to find individuals in contempt of courtincluding for failing to abide by the personal rules of the judgethis case shows how easily judges can abuse their power to punish people for seemingly innocuous offensesspanp pspanaccording to wral hahn was sent to speak with gilchrist directly about his refusal after gilchrist asked him again to wear a mask and he again refused gilchrist sentenced hahn to 24 hours in county jail after which he was swiftly taken into custody and held with no bond spanp pspanquotthe irony of all this whole thing is the judge was talking to me without a mask onquot hahn addedspanp pspanhahn a single father says gilchrist denied him the ability to call his son quoti was dumbfoundedquot hahn a hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640tolda wral quoti never thought this could happen in this countryquotspanp pspanwhile hahn was shocked by gilchrists response theres nothing illegal about it in the united states judges are given broad power to jail fine or otherwise punish individuals for contempt of court quotim not surprisedquot lisa wayne the executive director of the national association of criminal defense lawyers tells ireason iquotthe judge has complete jurisdiction to make rules within their courtrooms as long as it is not inconsistent to any kind of constitutional right that someone might havequotspanispan spanispanwayne notes that she once quothad a judge who would not allow women to wear pants in the courtroompantsuits that was the rule of the court or we would be found in contemptquotspanp pspanhahn may not have broken any laws when he refused to wear a mask in judge gilchrists courtroombut he was jailed nonetheless while judges should be able to maintain order in their courtrooms a particularly draconian judge can easily make offending their personal preferences into a jailable offense hahns runin with such a judge is a perfect example of how this power can be abusedand how easily one can fall victim to an overzealous enforcerspanp pthe post a relnofollow hrefhttpsreasoncom20221018anorthcarolinamanwasjailedforrefusingtowearamaskincourta north carolina man was jailed for refusing to wear a mask in courta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_1792127342400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_1792127341200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_179212734600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_179212734331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210dreamstime_xxl_1792127342400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210dreamstime_xxl_1792127341200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210dreamstime_xxl_179212734600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210dreamstime_xxl_179212734331x186jpg 331w img width1200 altface mask srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210dreamstime_xxl_179212734800x450jpg height675 picture div pspana north carolina man wasspan hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spanjailedspanaspan 24 hours contempt court week offense refusing wear mask courtspanp pspanon october 10spanspan gregory hahn arrived harnett county north carolina courthouse report jury duty local mask ordinances place mask mandate courthouse spanp pspanquotthere signs saying masks requiredquot hahn later toldspan hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spanwralspana local news stationp pspanhowever judge charles gilchrist rules arriving hahn 98 potential jurors informed masks required judge gilchrists courtroom quotyou district courtroom mask come superior clerk court mask [district attorneys] office mask judge gilchrist mandate wear maskquot clerk superior court renee whittentonspan hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640spantoldspanaspan wral adding superior court judges county gilchrist mask mandatespanp pspanwhen hahn refused mask found barsspandel delp pspanwhile judges wide latitude find individuals contempt courtincluding failing abide personal rules judgethis case shows easily judges abuse power punish people seemingly innocuous offensesspanp pspanaccording wral hahn sent speak gilchrist directly refusal gilchrist asked wear mask refused gilchrist sentenced hahn 24 hours county jail swiftly taken custody held bond spanp pspanquotthe irony thing judge talking mask onquot hahn addedspanp pspanhahn single father says gilchrist denied ability son quoti dumbfoundedquot hahn hrefhttpswwwwralcommaskdisputelandspotentialharnettcountyjurorinjail20520640tolda wral quoti thought happen countryquotspanp pspanwhile hahn shocked gilchrists response theres illegal united states judges given broad power jail fine punish individuals contempt court quotim surprisedquot lisa wayne executive director national association criminal defense lawyers tells ireason iquotthe judge complete jurisdiction rules courtrooms long inconsistent kind constitutional right havequotspanispanspanispanwayne notes quothad judge allow women wear pants courtroompantsuits rule court found contemptquotspanp pspanhahn broken laws refused wear mask judge gilchrists courtroombut jailed nonetheless judges able maintain order courtrooms particularly draconian judge easily offending personal preferences jailable offense hahns runin judge perfect example power abusedand easily fall victim overzealous enforcerspanp pthe post relnofollow hrefhttpsreasoncom20221018anorthcarolinamanwasjailedforrefusingtowearamaskincourta north carolina man jailed refusing wear mask courta appeared relnofollow hrefhttpsreasoncomreasoncomap

634f2a5a8ff7051128adf958

The Riddle of History, Solved

pemcommunism is the riddle of history solved and it knows itself to be this solution karl marx emeconomic and philosophic manuscripts of 1844p pas you can see according to karl marx communism true and proper is the selfconscious solution to the riddle of history of course in reality where things have to work there is no riddle of history the riddle of history marx referred to is in fact dialectical anthroposophy which is a really fancy for mancentered heretical nonsense thus any claim upon a solution to that riddle is pure pretense and dangerous hubris the true solution to the riddle of history if we should even allow such a phrase must begin with the outright rejection of communism and the dialectical framing in which the riddle is posed in the first place including the underlying assumption that history has a purpose and is thus a riddle to be solvedp pkarl marx did not reject that assumption however he began with it what to marx was the riddle of history solved other than just to say communism as described above its socialism that can produce that can deliver the goods one might say productive socialism that allows man to escape toil exploitation suffering and work which arrives when man is freed from the existence of private property and thus the division of labor which was his fall is the pathway to the transcendence of private property as human selfestrangement as marx had it the problem is that productive socialism is a functional oxymoronp pthe history of the twentieth century is basically the story of productive socialism not existing either in reality or in actuality these are different to marxists so far all bids to create it have fallen flat on their faces universally after starving and people by the millions in the pretense of having finally got it rightor at least good enough for government work the reason is straightforward history is not a riddle and the dialectic in which it is framed as such is bogus and ultimately a power grab for people who do not know how to wield power we therefore have every reason to expect the newest solution to the riddle of history which believes that it knows itself to be that solution is going to fail and do a ton of avoidable damage so long as we keep giving it any countenance utter failure has never slowed a communist down however so theyre doing what they always do when confronted with failure keeping their bogus product the same while giving its branding a faceliftp pthe fancy newfangled solution to the nonexistent riddle of history therefore now tends to go by the name sustainability or more specifically sustainable capitalism in sustainable capitalism the economy will be circular and you will own nothing and you will be happy weve heard this kind of talk before always from the mouths of the emissaries of mordor itll be great a better future that is both sustainable and inclusive our systems will be more resilient and we wont waste so much because well be reusing most of our waste didnt you see the video of bill gates smiling as he drank a glass of water pressed out of human sewage well eat far less meat and one presumes far more soy and bugs western values like individual liberty and the ownership of private property will hit their breaking points and be abolished and the united states will no longer be the worlds superpower because room has to be made for china and a new mirrorimage supranational west governed by the united nations most importantly this whole scam will be sustainable for the planet we live on the people we live among and even more most importantly for the regime that administers it for us thats the rub too well need someone to administer this unnatural nonsensical expensive crap for as long as it lasts because in that marx was wrong about us being a speciesbeing who has forgotten his true nature nobody is going to sign up for or maintain this disaster for themselves willinglyp plenin understood this that was the point of his vanguard strategy which he located in the bolshevik party thanks to the need to administer the proposed solution to the riddle of history you may have heard of sustainable capitalism referred to by another name stakeholder capitalism thats adorable lenin would smile administration of the sustainable capitalism has to be done by a council of expert stakeholders who in their greater wisdom and perspicacity make sure all the real stakeholders stakes are accounted for after being passed through the supremely informed and equitable filter of their claim to expertise thats why it was called the soviet union dont you know the russian word for the deciding council is soviet as it gets rendered in english the the stakeholders council will administer the sustainable capitalism that us rubes are too dumb and selfish to produce and maintain for ourselvesp pwhereem sustainable capitalismem is the solution to the socalled riddle of historyem stakeholder capitalismem is little more than its mechanism of implementation phrased more historically where sustainable capitalism is the riddle of history solved and the positive transcendence of private property to riff from karl marx stakeholder capitalism is the supranationalist leniniststyle vanguard program that will implement it for usrather on us that is because we wont be sustainable in the right sense by ourselves our elite betters are going to have to implement it upon us for usfor the greater good of all though we can only speculate this might be why klaus schwab alleged father of the stakeholder capitalism model has a bust of none other than vladimir lenin on the bookshelf in his office in other words stakeholder capitalism being offered as the vehicle to sustainable capitalism is just further proof that this whole giant socioeconomic ponzi scheme is going to fail catastrophically it actually gives away the game that theyve tucked away and hidden inside of a fancy new western technofuturist boxp pwhat weve already realized however is that theres another term that could pass equally well for what is meant by sustainable capitalism understood as the riddle of history solved that term would be emproductive socialismem which if administered long and hard enough will result in the people undergoing the positive transcendence of private property as human selfestrangement as they remember that they are and always were communists in their essential being thats what marx characterized it as communism as he had it is the true resolution of the strife between existence and essence between objectification and selfconfirmation between freedom and necessity between the individual and the species the problem is that through the inversion of praxis which is how the existing society allegedly brainwashes people into accepting its terms and thus reproducing it people cant solve the riddle of history they have had the wrong values introjected into them through the inversion of praxis as it was phrased in 1969 by the critical marxist herbert marcuse in his infamous emessay on liberationem they need to be freed from those and have new valuesa new sensibilityintrojected into them instead so that they can establish a true biological foundation for socialismp pthis productive socialism is what they pretend to have in china under the ccp now communist china can be looked at as the testrun for this brilliant new global scam they introject the correct values into the population not only through the usual oldfashioned methods like emduzhngem struggle and emxnoem brainwashing but also through forced compliance with a pervasive social credit system that makes you behave shall we say productively and sustainably the marxist doctrine of the inversion of praxis instructs that if you force people to live and practice the new values system eventually it will determine their character they will embecomeem socialists by being forced to live as socialistsp pthis is easily enough said but how did it get here the case for my claimthat sustainable capitalism and productive socialism are emsynonymsemderives from my reading of the leading critical marxist theorist of the 1960s herbert marcuse particularly in my view the second and ninth chapters of his emmagnum opusem titled emonedimensional manem and published in 1964 constitute the conceptual bedrock for the development of sustainable capitalism and that this concept represents nothing more than a westpalatable brand name for what would be more honestly called productive socialism i think this book rephrases the socalled riddle of history while never admitting the slightest doubt that socialism might not be its solution of course in the religion of marxism questioning the completion of history as truly transcendent capitalism which resolves the fall of man as the division of labor is roughly the same as asking a christian to doubt the resurrection which resolves the fall of man as the sin of adam its not going to happenp pin emonedimensional manem which reached and influenced hundreds of thousands if not millions of leftists in the 1960s and 1970sleftists who went on to become your college professors and your kids teachers college professors among other worldbuilding professionalsmarcuse wrestles with a number of midcentury challenges to the sputtering marxist sophistry which was barely chugging along on fumes everywhere outside of east asia and to a degree latin america prominent among them and essentially the thesis of his second chapter is the dialectical relationship between capitalism in the west and socialism in the east and south what that means is that capitalism and socialism are in some obscure senseem the same thingem viewed in different incorrectly opposing lights both areem partial answers to the riddle of historyem which finds its solution on a higher plane of understanding that synthesizes them both into a single program putting capitalism and socialism in a dialectical relationship in fact might have been marcuses most significant contribution to leftist thought because it in a sense poses the two great warring systems as two key insights to the socalled riddle of historyp pfor marcuse part of the solution exists in what he sees as the chief problem of capitalism the problem is that capitalism delivers the goods it enables the middle class to rise and the worker to have a good life that he enjoys he has stuff he isnt hungry or cold he isnt miserable though he is allegedly still exploited hes conditioned by the goodness of his life the inversion of praxis to accept and even enjoy itand he admits its absolutely true that his lifeem is a good lifeem that makes him onedimensional and completely ruins his revolutionary potential to be a revolutionary the worker has to be radicalized by making him miserable through the abuses of monopolycapital and exploiting that misery advanced capitalism as marcuse called it had fairly effectively put a stop to these abuses thus flattening man and conditioning him to accept and even love his largely meaningless and static onedimensional workadayconsumerist lifep pfor marcuse the working class was removed from his historical position as a revolutionary base by this evil success of advanced capitalism so much so that he insisted that a emnew working classem would need to be found through identity politics racial sexual feminist and more led by the more easily programmed college students mao preferentially emxnoemed the youth too and marcuse knew it in marcuses telling besides flattening man and thus locking his essential nature as a socialist away from his consciousness this successful dimension of capitalism creates an impending disaster of emexcessem capitalism delivers the goods but it turns people into relentless consumers whose needs multiply as fast as they can be satisfied meanwhile in his telling it profiteers off deliberately wasteful practices like planned obsolescence and the destruction of the limited natural environment capitalism emworksem in marcuses dialectical view of it but it works too well and simply isnt sustainablep pon the other hand of the grand riddle of history socialism has the right view of things the right sensibility argues marcuse but its a dump socialist nations were undeniable shitholesin fact far worse than that because they were brutally totalitarian and abusive marcuse pinned these failures on the abuses of bureaucracy and their tyrants but those in turn were to him the result of a specific problem that marxists of his era didnt know how to solve that problem is sometimes called emthe problem of productionem stated simply socialist societies cant produce they cannot even manage to meet the basic needs of their people and in their mounting failure to be able to produce they become brutal socialism for marcuse emhas it rightem but it emdoesnt workem if it did work it would be both productive and sustainable and the people would be happyp pthat riddle of history which i will insist defined marxist leftism a redundancy frankly in the tumultuous 1960s and stagnating 1970s was the framing in which stakeholder capitalism and the notion of a sustainable and inclusive future emerged i believe the soviet union for all its might was toast so the model was tested first in china it developed not under mao zedongthough important meetings between leaders like him richard nixon and henry kissinger proceeded perhaps to that themebut under his successor deng xiaoping who rose to chairman of the ccp within a couple of politically tumultuous years following maos death in september 1976p pthe productive socialism experiment as it might now be called was to open up restricted markets within china and chinese industry to western markets i dont care if the cat is black or white so long as it catches mice deng famously remarked so why not experiment with a marketsdriven solution to the problem of production in some sense it worked china was rapidly enriched and went from being a broken backwards and extremely populous nation with an economy roughly the size of italys to a global financial superpower in just a few decades they had it seemed cracked the code on emproductive socialismemp pthe trickem it seemedem was to open up quasicapitalist markets like little controlled terrariums inside the socialist architecture of the commanddriven communist state the trick in reality was probably little more than turning that humongous impoverished and easily exploitable population base into a gigantic manufacturing base for western consumer goods which is only good so long as it lasts the check might be coming due on this now for what its worthp pif the model could work in china why not in the westand thus in some sense everywhere the west obviously would naturally fall behind the rising commandeconomy behemoth in the east if it didnt transform as well right that makes for one hell of a sales pitch one that many of our western elites seem to have bought hook line and sinker to get productive socialism in the west especially in the united states where socialism is largely anathema what changes would be needed emthereemp pherbert marcuse told us youll definitely need a radicalized youth that believes it emcant even liveem without socialism and getting one of those is as simple a matter more or less as getting hold of the education system and disrupting family faith and national identity more would be needed too though a right understanding of emcapitalismem the basis of the west that synthetically moves it toward productive socialism would also be neededp pagain to believe herbert marcuse on the issue the problem with western capitalism wasnt that it couldnt produce its that it isnt sustainable the problem of advanced capitalism isnt production and the satisfaction of needs argues marcuse itsem overproductionem and thus the insatiable production of newer and newer emfalseem needs in the contemporary era the conquest of scarcity is still confined to small areas of advanced industrial society their prosperity covers up the inferno inside and outside their borders it also spreads a repressive productivity and false needs he tells usp pwhats to be done about these false needs generated by the excessive successes of advanced capitalism says herr marcuse the process always replaces one system of preconditioning by another the optimal goal is the replacement of false needs by true ones the abandonment of repressive satisfaction of course consciousness the marxists gnostic counterfeit of christian discernment and greek wisdom is needed to distinguish the two true needs are the actual basic needs of life not more which a government of productive socialism should provide thus liberating man from needing to provide them for himself false needs on the other hand can be identified through critical consciousness as well howeverp pwe may distinguish both true and false needs false are those which are superimposed upon the individual by particular social interests in his repression the needs which perpetuate toil aggressiveness misery and injustice their satisfaction might be most gratifying to the individual but this happiness is not a condition which has to be maintained and protected if it serves to arrest the development of the ability his own and others to recognize the disease of the whole and grasp the chances of curing the disease the result then is euphoria in unhappiness most of the prevailing needs to relax to have fun to behave and consume in accordance with the advertisements to love and hate what others love and hate belong to this category of false needsp pso much for relaxing and having fun in the socialist utopia comrades thats not all though liberation of energy from the performances required to sustain destructive prosperity advises marcuse in the ninth chapter ofem onedimensional manemem emmeans decreasing the high standard of servitude in order to enable the individuals to develop that rationality which may render possible a pacified existence it also presupposes reduction in the future population he points out in the next sentence written in 1964 when the population was roughly half what it is today but lets not digress into the uncomfortably obvious to achieve the parallel of productive socialism in the west capitalism would have to be modified to free up the energyrequired to sustain destructive prosperity and the denizens of western capitalistic nations would have to accept generally a lower standard of living and smaller population in other words capitalism would have to be made emsustainable and inclusiveem so were back to the socialist shitholes but in the new sustainable ones youll be happy not merely comfortable relaxed and euphoricp pi believe sustainable and inclusive capitalism is little more than the capitalistside solution to this false riddle of history posed in 1964 by herbert marcuse and that it knowsrather believesitself to be this solution the productive socialism of china under the hybrid system currently run by the ccp is the socialistside solution to the same and in fact these two are not significantly different in any noteworthy way these two sustainable capitalism and productive socialism are the two great systems dialectically reframed as part of a greater whole the impending shithole world of the new world order thus in china the communism is on the outside and the fascistic market structure is contained within to produce productive socialism and in the west perhaps mostly due to some combination of marketing constrains and dialectical wizardry the fascistic publicprivate partnership is on the outside with the equitable and inclusive redistribution scheme hidden within this though is a distinction without much difference both are in a position for ultimate synthesis into the great tyranny of the twentyfirst century in a bizarre twist of ironic inversion the chinese model will be the emnationalisticem one the west will not be allowed to be so luckyp pkarl marx said of theem true emsort of communism that it is the riddle of history solved and it knows itself to be the solution and this is characterized by the empositiveem transcendence of emprivate propertyem as emhuman selfestrangementem and therefore as the real emappropriationem of the emhumanem essence by and for man communism therefore as the complete return of man to himself as a emsocialem ie human being sustainable capitalism phrases this more plainly you will own nothing and you will be happy marx said about it that it as fully developed naturalism equals humanism and as fully developed humanism equals naturalism it is the emgenuineem resolution of the conflict between man and nature and between man and man the sustainable capitalists explain that its environmentally and socially responsible or sustainable and inclusive inclusion as a communist ideal is obvious of course but what about environmental sustainability karl marx explained this too though a bit more abstruselyp pjust as plants animals stones air light etc constitute theoretically a part of human consciousness partly as objects of natural science partly as objects of arthis spiritual inorganic nature spiritual nourishment which he must first prepare to make palatable and digestibleso also in the realm of practice they constitute a part of human life and human activity physically man lives only on these products of nature whether they appear in the form of food heating clothes a dwelling etc the universality of man appears in practice precisely in the universality which makes all nature his eminorganicem bodyboth inasmuch as nature is 1 his direct means of life and 2 the material the object and the instrument of his life activity nature is mans eminorganic bodyemnature that is insofar as it is not itself human body man emlivesem on naturemeans that nature is his embodyem with which he must remain in continuous interchange if he is not to die that mans physical and spiritual life is linked to nature means simply that nature is linked to itself for man is a part of naturep pin estranging from man 1 nature and 2 himself his own active functions his life activity estranged labour estranges the emspeciesem from man it changes for him the life of the species into a means of individual life first it estranges the emlife of the speciesem and individual life and secondly it makes individual life in its abstract form the purpose of the life of the species likewise in its abstract and estranged form emepmemp pweas a collectiveare nature apparently we as individuals sunder ourselves from nature both as nature itself and as the necessary window into our true emhumanem naturesas communists sustainable capitalism managed by klaus schwabs aka stakeholder capitalism allows the properly conscious to remedy this primordial marxist evil and it knows itself to be the solutionp pso i think ive made my case karl marx instructed in 1844 that the true communism is the selfconscious solution to the riddle of history and herbert marcuse 120 years later framed the riddle of history for the stage of advanced capitalism and faltering socialism to be how to synthesize them into a single functional system while productive socialism is not a term in the common use its western brand name sustainable capitalism is these are not different however theyre both approximately the same new iteration of communism a neocommunism based on marcusian neomarxism instead of marxian marxismp pthe whole thing is a scam and it will do incalculable damage if we allow it we dont have to allow it though we have a choice we can understand what were dealing with beneath the jargon and slick branding and we can say no marcuse said that overcoming the tyranny of the system he hated required what he called a great refusalthe protest against that which isand to that much i say yes we can refuse this scam whether we call it sustainable capitalism or productive socialism which is an oxymoron and get back to living history as it unfolds instead of falling on our faces by thinking its a riddle we can or should solvep pthe post a relnofollow hrefhttpsnewdiscoursescom202210riddleofhistorysolvedthe riddle of history solveda appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap

pemcommunism riddle history solved knows solution karl marx emeconomic philosophic manuscripts 1844p pas according karl marx communism true proper selfconscious solution riddle history course reality things work riddle history riddle history marx referred fact dialectical anthroposophy fancy mancentered heretical nonsense claim solution riddle pure pretense dangerous hubris true solution riddle history allow phrase begin outright rejection communism dialectical framing riddle posed place including underlying assumption history purpose riddle solvedp pkarl marx reject assumption began marx riddle history solved communism described socialism produce deliver goods productive socialism allows man escape toil exploitation suffering work arrives man freed existence private property division labor fall pathway transcendence private property human selfestrangement marx problem productive socialism functional oxymoronp pthe history twentieth century basically story productive socialism existing reality actuality different marxists far bids create fallen flat faces universally starving people millions pretense having finally got rightor good government work reason straightforward history riddle dialectic framed bogus ultimately power grab people know wield power reason expect newest solution riddle history believes knows solution going fail ton avoidable damage long giving countenance utter failure slowed communist theyre confronted failure keeping bogus product giving branding faceliftp pthe fancy newfangled solution nonexistent riddle history tends sustainability specifically sustainable capitalism sustainable capitalism economy circular happy weve heard kind talk mouths emissaries mordor itll great better future sustainable inclusive systems resilient wont waste reusing waste didnt video bill gates smiling drank glass water pressed human sewage eat far meat presumes far soy bugs western values like individual liberty ownership private property hit breaking points abolished united states longer worlds superpower room china new mirrorimage supranational west governed united nations importantly scam sustainable planet live people live importantly regime administers thats rub need administer unnatural nonsensical expensive crap long lasts marx wrong speciesbeing forgotten true nature going sign maintain disaster willinglyp plenin understood point vanguard strategy located bolshevik party thanks need administer proposed solution riddle history heard sustainable capitalism referred stakeholder capitalism thats adorable lenin smile administration sustainable capitalism council expert stakeholders greater wisdom perspicacity sure real stakeholders stakes accounted passed supremely informed equitable filter claim expertise thats called soviet union dont know russian word deciding council soviet gets rendered english stakeholders council administer sustainable capitalism rubes dumb selfish produce maintain ourselvesp pwhereem sustainable capitalismem solution socalled riddle historyem stakeholder capitalismem little mechanism implementation phrased historically sustainable capitalism riddle history solved positive transcendence private property riff karl marx stakeholder capitalism supranationalist leniniststyle vanguard program implement usrather wont sustainable right sense elite betters going implement usfor greater good speculate klaus schwab alleged father stakeholder capitalism model bust vladimir lenin bookshelf office words stakeholder capitalism offered vehicle sustainable capitalism proof giant socioeconomic ponzi scheme going fail catastrophically actually gives away game theyve tucked away hidden inside fancy new western technofuturist boxp pwhat weve realized theres term pass equally meant sustainable capitalism understood riddle history solved term emproductive socialismem administered long hard result people undergoing positive transcendence private property human selfestrangement remember communists essential thats marx characterized communism true resolution strife existence essence objectification selfconfirmation freedom necessity individual species problem inversion praxis existing society allegedly brainwashes people accepting terms reproducing people cant solve riddle history wrong values introjected inversion praxis phrased 1969 critical marxist herbert marcuse infamous emessay liberationem need freed new valuesa new sensibilityintrojected instead establish true biological foundation socialismp pthis productive socialism pretend china ccp communist china looked testrun brilliant new global scam introject correct values population usual oldfashioned methods like emduzhngem struggle emxnoem brainwashing forced compliance pervasive social credit system makes behave shall productively sustainably marxist doctrine inversion praxis instructs force people live practice new values system eventually determine character embecomeem socialists forced live socialistsp pthis easily said case claimthat sustainable capitalism productive socialism emsynonymsemderives reading leading critical marxist theorist 1960s herbert marcuse particularly view second ninth chapters emmagnum opusem titled emonedimensional manem published 1964 constitute conceptual bedrock development sustainable capitalism concept represents westpalatable brand honestly called productive socialism think book rephrases socalled riddle history admitting slightest doubt socialism solution course religion marxism questioning completion history truly transcendent capitalism resolves fall man division labor roughly asking christian doubt resurrection resolves fall man sin adam going happenp pin emonedimensional manem reached influenced hundreds thousands millions leftists 1960s 1970sleftists went college professors kids teachers college professors worldbuilding professionalsmarcuse wrestles number midcentury challenges sputtering marxist sophistry barely chugging fumes outside east asia degree latin america prominent essentially thesis second chapter dialectical relationship capitalism west socialism east south means capitalism socialism obscure senseem thingem viewed different incorrectly opposing lights areem partial answers riddle historyem finds solution higher plane understanding synthesizes single program putting capitalism socialism dialectical relationship fact marcuses significant contribution leftist thought sense poses great warring systems key insights socalled riddle historyp pfor marcuse solution exists sees chief problem capitalism problem capitalism delivers goods enables middle class rise worker good life enjoys stuff isnt hungry cold isnt miserable allegedly exploited hes conditioned goodness life inversion praxis accept enjoy itand admits absolutely true lifeem good lifeem makes onedimensional completely ruins revolutionary potential revolutionary worker radicalized making miserable abuses monopolycapital exploiting misery advanced capitalism marcuse called fairly effectively stop abuses flattening man conditioning accept love largely meaningless static onedimensional workadayconsumerist lifep pfor marcuse working class removed historical position revolutionary base evil success advanced capitalism insisted emnew working classem need found identity politics racial sexual feminist led easily programmed college students mao preferentially emxnoemed youth marcuse knew marcuses telling flattening man locking essential nature socialist away consciousness successful dimension capitalism creates impending disaster emexcessem capitalism delivers goods turns people relentless consumers needs multiply fast satisfied telling profiteers deliberately wasteful practices like planned obsolescence destruction limited natural environment capitalism emworksem marcuses dialectical view works simply isnt sustainablep pon hand grand riddle history socialism right view things right sensibility argues marcuse dump socialist nations undeniable shitholesin fact far worse brutally totalitarian abusive marcuse pinned failures abuses bureaucracy tyrants turn result specific problem marxists era didnt know solve problem called emthe problem productionem stated simply socialist societies cant produce manage meet basic needs people mounting failure able produce brutal socialism marcuse emhas rightem emdoesnt workem work productive sustainable people happyp pthat riddle history insist defined marxist leftism redundancy frankly tumultuous 1960s stagnating 1970s framing stakeholder capitalism notion sustainable inclusive future emerged believe soviet union toast model tested china developed mao zedongthough important meetings leaders like richard nixon henry kissinger proceeded themebut successor deng xiaoping rose chairman ccp couple politically tumultuous years following maos death september 1976p pthe productive socialism experiment called open restricted markets china chinese industry western markets dont care cat black white long catches mice deng famously remarked experiment marketsdriven solution problem production sense worked china rapidly enriched went broken backwards extremely populous nation economy roughly size italys global financial superpower decades cracked code emproductive socialismemp pthe trickem seemedem open quasicapitalist markets like little controlled terrariums inside socialist architecture commanddriven communist state trick reality probably little turning humongous impoverished easily exploitable population base gigantic manufacturing base western consumer goods good long lasts check coming worthp pif model work china westand sense west obviously naturally fall rising commandeconomy behemoth east didnt transform right makes hell sales pitch western elites bought hook line sinker productive socialism west especially united states socialism largely anathema changes needed emthereemp pherbert marcuse told youll definitely need radicalized youth believes emcant liveem socialism getting simple matter getting hold education system disrupting family faith national identity needed right understanding emcapitalismem basis west synthetically moves productive socialism neededp pagain believe herbert marcuse issue problem western capitalism wasnt couldnt produce isnt sustainable problem advanced capitalism isnt production satisfaction needs argues marcuse itsem overproductionem insatiable production newer newer emfalseem needs contemporary era conquest scarcity confined small areas advanced industrial society prosperity covers inferno inside outside borders spreads repressive productivity false needs tells usp pwhats false needs generated excessive successes advanced capitalism says herr marcuse process replaces system preconditioning optimal goal replacement false needs true ones abandonment repressive satisfaction course consciousness marxists gnostic counterfeit christian discernment greek wisdom needed distinguish true needs actual basic needs life government productive socialism provide liberating man needing provide false needs hand identified critical consciousness howeverp pwe distinguish true false needs false superimposed individual particular social interests repression needs perpetuate toil aggressiveness misery injustice satisfaction gratifying individual happiness condition maintained protected serves arrest development ability recognize disease grasp chances curing disease result euphoria unhappiness prevailing needs relax fun behave consume accordance advertisements love hate love hate belong category false needsp pso relaxing having fun socialist utopia comrades thats liberation energy performances required sustain destructive prosperity advises marcuse ninth chapter ofem onedimensional manemem emmeans decreasing high standard servitude order enable individuals develop rationality render possible pacified existence presupposes reduction future population points sentence written 1964 population roughly half today lets digress uncomfortably obvious achieve parallel productive socialism west capitalism modified free energyrequired sustain destructive prosperity denizens western capitalistic nations accept generally lower standard living smaller population words capitalism emsustainable inclusiveem socialist shitholes new sustainable ones youll happy merely comfortable relaxed euphoricp pi believe sustainable inclusive capitalism little capitalistside solution false riddle history posed 1964 herbert marcuse knowsrather believesitself solution productive socialism china hybrid system currently run ccp socialistside solution fact significantly different noteworthy way sustainable capitalism productive socialism great systems dialectically reframed greater impending shithole world new world order china communism outside fascistic market structure contained produce productive socialism west combination marketing constrains dialectical wizardry fascistic publicprivate partnership outside equitable inclusive redistribution scheme hidden distinction difference position ultimate synthesis great tyranny twentyfirst century bizarre twist ironic inversion chinese model emnationalisticem west allowed luckyp pkarl marx said theem true emsort communism riddle history solved knows solution characterized empositiveem transcendence emprivate propertyem emhuman selfestrangementem real emappropriationem emhumanem essence man communism complete return man emsocialem ie human sustainable capitalism phrases plainly happy marx said fully developed naturalism equals humanism fully developed humanism equals naturalism emgenuineem resolution conflict man nature man man sustainable capitalists explain environmentally socially responsible sustainable inclusive inclusion communist ideal obvious course environmental sustainability karl marx explained bit abstruselyp pjust plants animals stones air light etc constitute theoretically human consciousness partly objects natural science partly objects arthis spiritual inorganic nature spiritual nourishment prepare palatable digestibleso realm practice constitute human life human activity physically man lives products nature appear form food heating clothes dwelling etc universality man appears practice precisely universality makes nature eminorganicem bodyboth inasmuch nature 1 direct means life 2 material object instrument life activity nature mans eminorganic bodyemnature insofar human body man emlivesem naturemeans nature embodyem remain continuous interchange die mans physical spiritual life linked nature means simply nature linked man naturep pin estranging man 1 nature 2 active functions life activity estranged labour estranges emspeciesem man changes life species means individual life estranges emlife speciesem individual life secondly makes individual life abstract form purpose life species likewise abstract estranged form emepmemp pweas collectiveare nature apparently individuals sunder nature nature necessary window true emhumanem naturesas communists sustainable capitalism managed klaus schwabs aka stakeholder capitalism allows properly conscious remedy primordial marxist evil knows solutionp pso think ive case karl marx instructed 1844 true communism selfconscious solution riddle history herbert marcuse 120 years later framed riddle history stage advanced capitalism faltering socialism synthesize single functional system productive socialism term common use western brand sustainable capitalism different theyre approximately new iteration communism neocommunism based marcusian neomarxism instead marxian marxismp pthe thing scam incalculable damage allow dont allow choice understand dealing beneath jargon slick branding marcuse said overcoming tyranny system hated required called great refusalthe protest isand yes refuse scam sustainable capitalism productive socialism oxymoron living history unfolds instead falling faces thinking riddle solvep pthe post relnofollow hrefhttpsnewdiscoursescom202210riddleofhistorysolvedthe riddle history solveda appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap

634f2a828ff7051128adf95e

Will there be a snap election?

pin an interview with the bbc last night 17 october the prime minister said im sticking around because i was elected to deliver for this countryp pthat is not entirely accurate only 81326 conservative party members or 017 per cent of the national electorate voted for a relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa in the summer in any case many of the policies and principles she was elected on have now been scrapped besides the prime minister has already departed drastically from a relnoopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsonas 2019 manifesto implementing policies the conservative majority wasnt elected to deliver a majority that the past week has proved she is unable to commandp pthis lack of authority has led to speculation about not to mention calls from opposition parties for a snap general election a prime minister with no mandate opponents of truss argue should go to the country to regain onep phowever the chances of truss calling an election are slim to nonexistent firstly because her poll ratings are dire the pm is nearly as unpopular as a relnoopener hrefhttpswwwnewstatesmancomtagvladimirputin target_blankvladimir putina secondly tory mps would probably replace truss if she tried to force them into an election considering the high probability per the polls of them losing their seatsp pa more interesting question is whether an election might be more likely if the conservatives oust truss and appoint yet another leaderp pthe argument goes that if a new prime minister was chosen by tory mps rather than voted for by members in a full leadership contest they would have even less of a mandate to govern than truss if a relnoopener hrefhttpswwwnewstatesmancomtagrishisunak target_blankrishi sunaka became pm perhaps he could argue that he received 60000 votes from the membership in the summers contest but thats a stretch of legitimacy even for the tory party like truss the new prime minister would be implementing a policy platform far removed from what was promised in 2019 therefore seeing as no one voted for austerity wouldnt they be tempted to cement their validity by going to the peoplep pthe answer is probably not britain has a parliamentary system it was the conservative party not boris johnson that was elected in 2019 with an 80seat majority that now slightly diminished majority gives whoever is party leader a mandate to be prime minister the crises of covid the war in ukraine and market turbulence since the minibudget gives the new pm a doctors mandate to divert from 2019 as long as they can command a majority of mps something that truss almost certainly cannot do they will be able to struggle on for two more years until the end of the parliamentary termp punless the polls change significantly hanging on is far more appealing a prospect than an election in which the new pm risks losing if a general election was to be held tomorrow the emnew statesmanems a relnoopener hrefhttpssotnnewstatesmancom202210britainpredicts target_blankelection modela predicts the conservatives would lose 324 seats leaving them with fewer mps in westminster than the snp electoral annihilation wouldnt be the top priority for any new prime ministerp panother wildcard is the redrawing of constituency boundaries in late 2023 they are due to change for the first time since 2010 the conservatives are expected to gain a slight advantage from this because of fewer seats in northern england wales and scotland but this benefit a relnoopener hrefhttpswwwnewstatesmancompoliticsthestaggers202102whatwillboundarychangesmeanlabourandconservatives target_blankmay not be as large as has been expecteda and some prominent tory mps may find their seats at risk there have been estimates of tenseat boundary gains for the party but even that pales in comparison with its projected losses nonetheless the moves will surely play on the mind of a new leader deciding when to go to the pollsp pwhether a general election is called will be down to political momentum if the tories pick another leader and see a popularity spike in the polls perhaps they will take their chances before a predicted mortgage crisis hits and the spending cuts begin or perhaps theyll savour their time in no 10 and hold out hoping the situation will improve before january 2025 when the parliamentary term runs out in either case theyll have to get rid of truss first p pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210racesucceedliztrussbegins target_blankthe race to succeed liz truss beginsa]emstrongp

pin interview bbc night 17 october prime minister said im sticking elected deliver countryp pthat entirely accurate 81326 conservative party members 017 cent national electorate voted relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa summer case policies principles elected scrapped prime minister departed drastically relnoopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsonas 2019 manifesto implementing policies conservative majority wasnt elected deliver majority past week proved unable commandp pthis lack authority led speculation mention calls opposition parties snap general election prime minister mandate opponents truss argue country regain onep phowever chances truss calling election slim nonexistent firstly poll ratings dire pm nearly unpopular relnoopener hrefhttpswwwnewstatesmancomtagvladimirputin target_blankvladimir putina secondly tory mps probably replace truss tried force election considering high probability polls losing seatsp pa interesting question election likely conservatives oust truss appoint leaderp pthe argument goes new prime minister chosen tory mps voted members leadership contest mandate govern truss relnoopener hrefhttpswwwnewstatesmancomtagrishisunak target_blankrishi sunaka pm argue received 60000 votes membership summers contest thats stretch legitimacy tory party like truss new prime minister implementing policy platform far removed promised 2019 seeing voted austerity wouldnt tempted cement validity going peoplep pthe answer probably britain parliamentary system conservative party boris johnson elected 2019 80seat majority slightly diminished majority gives party leader mandate prime minister crises covid war ukraine market turbulence minibudget gives new pm doctors mandate divert 2019 long command majority mps truss certainly able struggle years end parliamentary termp punless polls change significantly hanging far appealing prospect election new pm risks losing general election held tomorrow theemnew statesmanemsa relnoopener hrefhttpssotnnewstatesmancom202210britainpredicts target_blankelection modelapredicts conservatives lose 324 seats leaving fewer mps westminster snpelectoral annihilation wouldnt priority new prime ministerp panother wildcard redrawing constituency boundaries late 2023 change time 2010 conservatives expected gain slight advantage fewer seats northern england wales scotland benefita relnoopener hrefhttpswwwnewstatesmancompoliticsthestaggers202102whatwillboundarychangesmeanlabourandconservatives target_blankmay large expecteda prominent tory mps find seats risk estimates tenseat boundary gains party pales comparison projected losses nonetheless moves surely play mind new leader deciding pollsp pwhether general election called political momentum tories pick leader popularity spike polls chances predicted mortgage crisis hits spending cuts begin theyll savour time 10 hold hoping situation improve january 2025 parliamentary term runs case theyll rid truss firstp pstrongem[see relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210racesucceedliztrussbegins target_blankthe race succeed liz truss beginsa]emstrongp

634f2add8ff7051128adf966

Biden to announce first bill he'd send to new Democratic Congress would codify Roe v. Wade

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden on tuesday will announce that the first bill he would send to congress if democrats retain their majorities would be one to codify the roe v wade ruling on abortion rights p pbiden is set to make the remarks at an event in washington dc hosted by the democratic national committee p pit illustrates how democrats and biden want to put the emphasis on abortion rights ahead of the midterms as new polls suggest the party is losing momentum in its effort to retain the senate and house p pbidens announcement has caveats sending the bill is dependent on democrats retaining the house which has always looked like an uphill climb and increasing their senate majority which could allow democrats to change the rules surrounding the filibuster increasing the number of democratic senators is possible in this years midterms though democrats have increasing worries about losing the chamber entirely given tight races across the country p phe will say that if the american people elect more democratic senators in november and keep the house democratic the first bill he will send to the next congress will be to codify roe and he will sign it around the 50th anniversary of the roe decision a democratic official told the hill ahead of the speechp pthe supreme courts roe v wade decision was on jan 22 1973 and the 50th anniversary would be just days after a new congress is sworn inp pbiden in his remarks plans to outline that nearly half the states have either passed a ban on abortion or are planning to and he will mention that in some states abortion is banned in cases of rape and incestp ppresident biden will speak about the choice that voters face this november between republicans who want to a national abortion ban that would criminalize doctors for performing care and democrats who want to codify roe into law to protect womens reproductive freedom the official saidp pthroughout this midterm cycle democrats have focused their campaign pitches on abortion rights and saw reproductive health as a winning issue as red states have moved towards restrictive laws democrats are a relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3693208democratsfocusedonabortionrightsworrytheyrelosingindependentwomen target_blankfacing headwindsa with independent women however who they worry could now be more focused on gas prices and inflation than abortionp prising gas prices and stubborn inflation are both seen as issues making it much tougher for democrats to hold on to the senate this fall p

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden tuesday announce bill send congress democrats retain majorities codify roe v wade ruling abortion rights p pbiden set remarks event washington dc hosted democratic national committee p pit illustrates democrats biden want emphasis abortion rights ahead midterms new polls suggest party losing momentum effort retain senate house p pbidens announcement caveats sending bill dependent democrats retaining house looked like uphill climb increasing senate majority allow democrats change rules surrounding filibuster increasing number democratic senators possible years midterms democrats increasing worries losing chamber entirely given tight races country p phe american people elect democratic senators november house democratic bill send congress codify roe sign 50th anniversary roe decision democratic official told hill ahead speechp pthe supreme courts roe v wade decision jan 22 1973 50thanniversary days new congress sworn inp pbiden remarks plans outline nearly half states passed ban abortion planning mention states abortion banned cases rape incestp ppresident biden speak choice voters face november republicans want national abortion ban criminalize doctors performing care democrats want codify roe law protect womens reproductive freedom official saidp pthroughout midterm cycle democrats focused campaign pitches abortion rights saw reproductive health winning issue red states moved restrictive laws democrats area relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3693208democratsfocusedonabortionrightsworrytheyrelosingindependentwomen target_blankfacing headwindsawith independent women worry focused gas prices inflation abortionp prising gas prices stubborn inflation seen issues making tougher democrats hold senate fall p

634f2bcd8ff7051128adf990

The race to succeed Liz Truss begins

pthe government made perhaps the a relnoopener nofollow hrefhttpswwwbbccouknewsbusiness63290139 target_blankbiggest retreat in economica history yesterday a relnoopener hrefhttpswwwnewstatesmancomtagjeremyhunt target_blankjeremy hunta the chancellor scrapped nearly all of last months minibudget and went further by cancelling the boris johnson administrations planned cut in the basic rate of income taxp pthe a relnoopener hrefhttpswwwnewstatesmancomtagenergybills target_blankenergy price guaranteea was also reduced from two years to six months this was the policy a relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa had used to shield her tax cuts from criticism and distinguish herself from labour it was the biggest part of the a relnoopener hrefhttpswwwnewstatesmancomtagminibudget target_blankminibudgeta the prime minister said now that asset has gone as i a relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210jeremyhunttrashestheremainderofliztrusssprojectandspeedsupthetimelineforherremoval target_blankwrote yesterdaya the humiliation of appointing a chancellor to gut your own budget has hastened her exitp pindeed truss seemed to be in hiding yesterday smarting perhaps from her authoritysapping press conference on friday maybe shed been advised to avoid public speaking as much as possible but her absence allowed her rivals to fill the void the contest to replace truss began on the floor of the house of commons yesterdayp pa relnoopener hrefhttpswwwnewstatesmancomtagpennymordaunt target_blankpenny mordaunta who came third in the conservative leadership election over the summer stood in for the prime minister during an urgent question her confident wry appearance threw trusss stylistic weaknesses into sharp relief mordaunt didnt try to hide her relish i fully appreciate the optics of me appearing at the dispatch box she said tellinglyp plater in the afternoon hunt assumed the role of prime minister in all but name liz truss sat beside him in the commons chamber unmoving as he decimated the policies the party membership elected her to deliver higher taxes and spending cuts have now replaced tax cuts and deregulation her governments mandate has been extinguishedp pnonetheless the direction of tory mps is uncertain while most accept that trusss time is up there is no agreement on the mechanism for her removal or her replacement some may want mordaunt others hunt others rishi sunak the calming of the market turmoil unleashed by the minibudget has also made trusss exit seem less urgent her performance at prime ministers questions tomorrow could give the rebels momentum but they dont know what theyll do yet so we cant know eitherp pemthis piece first appeared in the morning call newsletter subscribe ema relnoopener hrefhttpswwwnewstatesmancompoliticsmorningcall202106subscribetomorningcall target_blankemhereemaememp pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210snapgeneralelectionliztrussuk target_blankwill liz truss call a general electiona]emstrongp

pthe government relnoopener nofollow hrefhttpswwwbbccouknewsbusiness63290139 target_blankbiggest retreat economica history yesterday relnoopener hrefhttpswwwnewstatesmancomtagjeremyhunt target_blankjeremy hunta chancellor scrapped nearly months minibudget went cancelling boris johnson administrations planned cut basic rate income taxp pthe relnoopener hrefhttpswwwnewstatesmancomtagenergybills target_blankenergy price guaranteea reduced years months policy relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa shield tax cuts criticism distinguish labour biggest relnoopener hrefhttpswwwnewstatesmancomtagminibudget target_blankminibudgeta prime minister said asset gone relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210jeremyhunttrashestheremainderofliztrusssprojectandspeedsupthetimelineforherremoval target_blankwrote yesterdaya humiliation appointing chancellor gut budget hastened exitp pindeed truss hiding yesterday smarting authoritysapping press conference friday maybe shed advised avoid public speaking possible absence allowed rivals fill void contest replace truss began floor house commons yesterdayp pa relnoopener hrefhttpswwwnewstatesmancomtagpennymordaunt target_blankpenny mordaunta came conservative leadership election summer stood prime minister urgent question confident wry appearance threw trusss stylistic weaknesses sharp relief mordaunt didnt try hide relish fully appreciate optics appearing dispatch box said tellinglyp plater afternoon hunt assumed role prime minister liz truss sat commons chamber unmoving decimated policies party membership elected deliver higher taxes spending cuts replaced tax cuts deregulation governments mandate extinguishedp pnonetheless direction tory mps uncertain accept trusss time agreement mechanism removal replacement want mordaunt hunt rishi sunak calming market turmoil unleashed minibudget trusss exit urgent performance prime ministers questions tomorrow rebels momentum dont know theyll cant know eitherp pemthis piece appeared morning newsletter subscribeema relnoopener hrefhttpswwwnewstatesmancompoliticsmorningcall202106subscribetomorningcall target_blankemhereemaememp pstrongem[see relnoopener hrefhttpswwwnewstatesmancompoliticsukpolitics202210snapgeneralelectionliztrussuk target_blankwill liz truss general electiona]emstrongp

63507b15f7b0b1720b03188b

Florida Corrections Officers Paralyzed A Man, Then Left Him in Solitary Confinement

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210screenshotsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210screenshots1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210screenshots600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210screenshots331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210screenshotsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210screenshots1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210screenshots600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210screenshots331x186jpg 331w img width1200 altcraig ridley srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpg height675 picture div pspancraig ridley died in 2017 after corrections officers paralyzed him and left him in solitary confinement for days without access to food a medical examiner ruled ridleys death a homicideyet state and federal prosecutors brought no charges in the casespanp pspanan investigation recently spana hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreleasedspanaspan by the spanispanmiami herald spanispansheds further light on the incident which occurred in 2017and includes spana hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle267217512htmlspanvideospanaspan of officers repeatedly refusing to believe the injured ridleys claims that he couldnt walk and had been paralyzed ridleys death marks the third time in recent years that corrections officers have broken florida inmatesspan a hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle243711077htmlspannecksspana a hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle234673557htmlspanduringspanaspan prison beatings it is yet another abuse case inside florida prisons with seemingly no consequences for those responsiblespanp pspancraig ridley was an inmate working in the kitchen at the florida department of corrections reception and medical center serving a 20year mandatory minimum sentence for attempted murder chargesspan a hrefhttpswwwmiamiheraldcomarticle266896361htmlspanaccordingspanaspan to the spanispanherald spanispanon september 8spanspanthspanspan 2017 an altercation occurred in which craig ridley was tackled to the ground facefirst by corrections officers dislocating his neckspanp pspanquotmy neck is brokequotspan a hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle267217512htmlspanridley spanspantoldspanaspan officers shortly after his injury quotim paralyzedquotspana hrefhttpswwwmiamiheraldcomarticle266896361html spanaccordingspanaspan to the spanispanheraldspanispan which obtained a 383page report about the incident one inmate later claimed that an officer told ridley quotyoure bullshitting youre just trying to get a lawsuitquotspanp pspanafter a short medical exam correctional officers took ridley to solitary confinement placing ridley on the cells toilet ridley shortly fell off it breaking his nose the spanispanheraldspani a hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan that ridleys cellmate moise cherette began banging on the cells door and calling for helpthough no staff immediately came to ridleys aid eventually ridley was taken to be examined by a prison doctor who found that ridley was not injuredspanp pspanin the coming days other inmates alerted officers to ridleys condition however the spanispanheraldspani a hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan that officers and nurses did nothingwalking by ridleys cell 173 times over five days quotfor five days i watch them starve himquot cherette wrote to florida department of law enforcement investigators quot[t]hey aint feed him or nothing every time they stop he tell them that he cant move the nurse laugh an make jokes and keep goingquot  spanp pa hrefhttpswwwmiamiheraldcomarticle266896361htmlspanaccordingspanaspan to spanispanthe herald spanispanthe florida department of law enforcements report of the incident showed that quotat least 11 inmates in his cell block reported that ridley never moved from his bunk did not pick up his food trays and that the officers ignored him and said he was fakingquotspanp pspanon september 12spanspanthspanspan corrections officer jesse mallard noticed ridleys unusual behavior with fdle stating that mallard quotstated something did not feel right with how ridley was actingquot the spanispanheraldspani a hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan that ridley was again taken for medical examination after which prison doctors sent ridley to memorial hospital in jacksonville in the early hours of september 13th where he was intubatedspanp pspanridley died one month later on october 12spanspanthspanspan a medical examinerspan a hrefhttpswwwmiamiheraldcomarticle266896361htmlspanruledspanaspan the death a homicide citing the cause of death as quotblunt impactquot to the head and neck a spinal cord injury and quotcomplications of quadriplegiaquotspanp pspanquotthere should have been criminal charges to come out of thisquot aubrey land a former investigator with the florida department of law enforcementspan a hrefhttpswwwmiamiheraldcomarticle266896361htmlspantoldspanaspan the spanispanherald spanispanquotthere is serious medical neglect evidence of falsifying documents and a man that died it looks mighty badquotspanp pspanridleys death is part of a larger pattern of behavior by guards in florida prisons in 2018 inmate cheryl weimar wasspan a hrefhttpsreasoncom20190904lawsuitsavagebeatingbyguardsatfloridawomensprisonleavesinmateparalyzedspanparalyzedspanaspan from the neck down after prison guards beat her nearly to death in 2020 a florida corrections officer brutally beatspan a hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle243711077htmlspanhandcuffedspanaspan inmate christopher howell breaking his neck and killing him spanp pspanquotthis was an inhumane death caused by an abysmal lack of medical treatmentquot diane ridley gatewood ridleys sister a hrefhttpswwwmiamiheraldcomarticle266896361htmltolda the spanispanherald spanispanquotit was torturequotspanp pthe post a relnofollow hrefhttpsreasoncom20221019floridacorrectionsofficersparalyzedamanthenlefthiminsolitaryconfinementflorida corrections officers paralyzed a man then left him in solitary confinementa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210screenshotsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210screenshots1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210screenshots600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210screenshots331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210screenshotsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210screenshots1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210screenshots600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210screenshots331x186jpg 331w img width1200 altcraig ridley srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210screenshots800x450jpg height675 picture div pspancraig ridley died 2017 corrections officers paralyzed left solitary confinement days access food medical examiner ruled ridleys death homicideyet state federal prosecutors brought charges casespanp pspanan investigation recently spana hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreleasedspanaspan spanispanmiami herald spanispansheds light incident occurred 2017and includes spana hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle267217512htmlspanvideospanaspan officers repeatedly refusing believe injured ridleys claims couldnt walk paralyzed ridleys death marks time recent years corrections officers broken florida inmatesspan hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle243711077htmlspannecksspana hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle234673557htmlspanduringspanaspan prison beatings abuse case inside florida prisons seemingly consequences responsiblespanp pspancraig ridley inmate working kitchen florida department corrections reception medical center serving 20year mandatory minimum sentence attempted murder chargesspan hrefhttpswwwmiamiheraldcomarticle266896361htmlspanaccordingspanaspan spanispanherald spanispanon september 8spanspanthspanspan 2017 altercation occurred craig ridley tackled ground facefirst corrections officers dislocating neckspanp pspanquotmy neck brokequotspan hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle267217512htmlspanridley spanspantoldspanaspan officers shortly injury quotim paralyzedquotspana hrefhttpswwwmiamiheraldcomarticle266896361html spanaccordingspanaspan spanispanheraldspanispan obtained 383page report incident inmate later claimed officer told ridley quotyoure bullshitting youre trying lawsuitquotspanp pspanafter short medical exam correctional officers took ridley solitary confinement placing ridley cells toilet ridley shortly fell breaking nose spanispanheraldspani hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan ridleys cellmate moise cherette began banging cells door calling helpthough staff immediately came ridleys aid eventually ridley taken examined prison doctor found ridley injuredspanp pspanin coming days inmates alerted officers ridleys condition spanispanheraldspani hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan officers nurses nothingwalking ridleys cell 173 times days quotfor days watch starve himquot cherette wrote florida department law enforcement investigators quot[t]hey aint feed time stop tell cant nurse laugh jokes goingquotspanp pa hrefhttpswwwmiamiheraldcomarticle266896361htmlspanaccordingspanaspan spanispanthe herald spanispanthe florida department law enforcements report incident showed quotat 11 inmates cell block reported ridley moved bunk pick food trays officers ignored said fakingquotspanp pspanon september 12spanspanthspanspan corrections officer jesse mallard noticed ridleys unusual behavior fdle stating mallard quotstated feel right ridley actingquot spanispanheraldspani hrefhttpswwwmiamiheraldcomarticle266896361htmlspanreportsspanaspan ridley taken medical examination prison doctors sent ridley memorial hospital jacksonville early hours september 13th intubatedspanp pspanridley died month later october 12spanspanthspanspan medical examinerspan hrefhttpswwwmiamiheraldcomarticle266896361htmlspanruledspanaspan death homicide citing cause death quotblunt impactquot head neck spinal cord injury quotcomplications quadriplegiaquotspanp pspanquotthere criminal charges come thisquot aubrey land investigator florida department law enforcementspan hrefhttpswwwmiamiheraldcomarticle266896361htmlspantoldspanaspan spanispanherald spanispanquotthere medical neglect evidence falsifying documents man died looks mighty badquotspanp pspanridleys death larger pattern behavior guards florida prisons 2018 inmate cheryl weimar wasspan hrefhttpsreasoncom20190904lawsuitsavagebeatingbyguardsatfloridawomensprisonleavesinmateparalyzedspanparalyzedspanaspan neck prison guards beat nearly death 2020 florida corrections officer brutally beatspan hrefhttpswwwmiamiheraldcomnewsspecialreportsfloridaprisonsarticle243711077htmlspanhandcuffedspanaspan inmate christopher howell breaking neck killing himspanp pspanquotthis inhumane death caused abysmal lack medical treatmentquot diane ridley gatewood ridleys sister hrefhttpswwwmiamiheraldcomarticle266896361htmltolda spanispanherald spanispanquotit torturequotspanp pthe post relnofollow hrefhttpsreasoncom20221019floridacorrectionsofficersparalyzedamanthenlefthiminsolitaryconfinementflorida corrections officers paralyzed man left solitary confinementa appeared relnofollow hrefhttpsreasoncomreasoncomap

63507b3ef7b0b1720b031894

Trump Was Far From the Most Pro-Israel U.S. President Ever

in many ways trumps actions weakened both israels security and that of the jewish community in the united states

ways trumps actions weakened israels security jewish community united states

63507bc6f7b0b1720b0318a4

Biden says Putin’s only tool now is to 'brutalize' after he declares martial law in Ukrainian regions

ppresident biden on wednesday said that vladimir putins only available tool right now in his war against ukraine is the brutalization of its citizens in the wake of the russian president declaring martial law in the four ukrainian regions he recently annexedp pi think that vladimir putin finds himself in an incredibly difficult position and what it reflects to me is it seems his only tool available to him is to brutalize individual citizens in ukraine ukrainian citizens to try to intimidate them into capitulating biden told reporters p ptheyre not going to do that he addedp pthe president has projected confidence in the ukrainian people since russia first invaded the country in february consistently saying that they will not back down from defending ukraine p pputin launched his latest round of drone strikes on kyiv on monday taking aim at infrastructure to harm civiliansp pat least three people were killed including a young couple expecting a child as 28 drones pounded on the capitalp pthe escalation follows setbacks for the russian military while ukrainian forces have continued to make major gains p pputins martial law order goes into effect on thursday in the regions of luhansk donetsk zaporizhzhia and kherson and gives additional emergency powers to regional leaders in russia p pdraft legislation a hrefhttpsthehillcompolicyinternational3695385putindeclaresmartiallawinannexedukrainianregionsreportedlya suggests that the order may include restrictions on travel and public gatherings increased censorship and expanded law enforcement authorityp

ppresident biden wednesday said vladimir putins available tool right war ukraine brutalization citizens wake russian president declaring martial law ukrainian regions recently annexedp pi think vladimir putin finds incredibly difficult position reflects tool available brutalize individual citizens ukraine ukrainian citizens try intimidate capitulating biden told reportersp ptheyre going addedp pthe president projected confidence ukrainian people russia invaded country february consistently saying defending ukrainep pputin launched latest round drone strikes kyiv monday taking aim infrastructure harm civiliansp pat people killed including young couple expecting child 28 drones pounded capitalp pthe escalation follows setbacks russian military ukrainian forces continued major gainsp pputins martial law order goes effect thursday regions luhansk donetsk zaporizhzhia kherson gives additional emergency powers regional leaders russia p pdraft legislationa hrefhttpsthehillcompolicyinternational3695385putindeclaresmartiallawinannexedukrainianregionsreportedlya suggests order include restrictions travel public gatherings increased censorship expanded law enforcement authorityp

63507c0bf7b0b1720b0318af

Suella Braverman resigns and becomes the Tory right’s new figurehead

pwe can now add cabinet revolt to the list of problems threatening the prime ministers increasingly precarious position suella braverman has resigned as home secretary after sharing an official document via her personal email but her resignation letter makes it clear that the direction of government is the main reason for her departurep pshe wrote that pretending we havent made mistakes carrying on as if everyone cant see that we have made them and hoping that everything will come right is not serious politicsp pbraverman has strong support among rightwing mps in the parliamentary party and her resignation demonstrates the extent to which truss is now isolated from that faction grant shapps who supported rishi sunak during the leadership contest has been mooted as a replacement for braverman which may help the prime minister broaden her support among conservativesp pbraverman is the second cabinet minister to leave the government in less than a week after truss was forced to sack the former chancellor kwasi kwarteng last friday 14 october with their departure the prime minister has lost key allies within the cabinet some tory mps are suggesting they will rebel tonight in a vote on fracking that the government has described as a confidence ballot the prime ministers fate could soon be sealedp

pwe add cabinet revolt list problems threatening prime ministers increasingly precarious position suella braverman resigned home secretary sharing official document personal email resignation letter makes clear direction government main reason departurep pshe wrote pretending havent mistakes carrying cant hoping come right politicsp pbraverman strong support rightwing mps parliamentary party resignation demonstrates extent truss isolated faction grant shapps supported rishi sunak leadership contest mooted replacement braverman help prime minister broaden support conservativesp pbraverman second cabinet minister leave government week truss forced sack chancellor kwasi kwarteng friday 14 october departure prime minister lost key allies cabinet tory mps suggesting rebel tonight vote fracking government described confidence ballot prime ministers fate soon sealedp

6351cccd04ab371b37888741

Siddhartha Mukherjee on Aristotle, COVID, and the ‘new human’

pwhen the harvardtrained physician and pulitzer prizewinning author siddhartha mukherjee talks about a new human he doesnt mean keanu reeves in a black muumuu as he writes in his new book the song of the cell an exploration of medicine and the new human instead mukherjees new human is more like the paradoxical ship of theseus over time each of the vessels original planks is removed and replaced with new wood what if a human could be rebuilt the same way with healthy replacements for aging or malfunctioning cells is that the same human or a new onep pin song of the cell set to be published next week mukherjee explores these questions and others  through stories from his own life his efforts to diagnose and save patients including one who barely survives a literal bloodbath his own battle with a stubborn depression during the pandemic and his fathers death he talked about the experiences and research behind the book in a conversation with the gazette the interview was edited for clarity and lengthp h2qampah2 h3siddhartha mukherjeeh3 pspangazettespan throughout the book you reference not just historical scientific figures but also poets and philosophers going as far back as aristotle how can ancient ideas help us understand modern medicinep pspanmukherjeespan its often forgotten that aristotle was probably as much a biologist as he was a philosopher the distinction between a natural scientist and philosopher was much blurrier then than it is today for people like aristotle questions like where do we come from and what are we made of were very much questions of the natural sciences as well as philosophyp pspangazettespan many of the stories you include are about medical failures or attempts to find cures that didnt go quite right like for example when a physician tried to cure a patients psychiatric symptoms with an infusion of cows blood or more recently with the first bonemarrow transplantsp pspanmukherjeespan in principle why emcantem human beings be transfused with cows blood it looks similar under the microscope what is it about cows blood thats different from human blood these failures are in some ways the beginnings of successful journeys they also showcase science as a human endeavor thats full of flaws we make mistakes we misunderstand things we misunderstand each otherp pi had this impromptu meeting with the nurses who worked on the first bonemarrow transplants and they spontaneously started talking about the massive litany of failures they cried they hugged each other they remembered the little boy in the bunker the pilot who was fogged by plutonium and died from leukemia and then they started talking about the successes that was one story that really stuck with mep pspangazettespan you dedicate a chapter to the pandemic and how it exposed such deep and fundamental shortcomings in our knowledge of the biology of a system that we had thought we knewp pspanmukherjeespan in all the sciences you get to a point where you develop a kind of hubris and then something walks you back there was a kind of hubris about newtonian mechanics or understanding electricity and magnetism or atomic structure until suddenly people realized that if you go deeper into those areas what was known didnt compute the pandemic demanded a kind of reevaluation of what we do and dont know and not just about the immune system because covid impacts the immune system our intestines our respiratory systems all the things that we thought we understood at a very deep level all are being reevaluated in the context of this virus and perhaps other viruses that will come after itp pspangazettespan in the books last chapter you talk about understanding cellular songs how individual cells work together like an orchestra why is that such an important frontier to explorep pspanmukherjeespan to understand or build an organism you ultimately need to understand the communications between individual parts of the organism we are beginning to understand the parts but not the sum of the parts the communications that go between organisms or what i would call cellular ecology the example that comes to mind is the famous conundrum of cancer metastases why arent there metastases in the spleen the liver is a frequent site of metastasis why is it the anatomy is it the ecology of the cells around it ill give you one more example why are there such frequent metastases in whats called the axial skeleton the central skeleton but very few in the distal skeleton in your fingers or in the other bones in your body the answer or answers have to do with understanding not just anatomy but how cells communicate with each other in this case how cancer cells build homes around each other thats one of the mysteries that we need to understand and thats why the book is called the song of the cellp pspangazettespan you also introduce the idea of a new human which could be built rather than simply born today many fear this kind of cellular manipulation but you seem to caution people against that fearp pspanmukherjeespan i like that cautioning people against fear im not blithe about it either i have my reservations ive seen bone marrow transplants go horribly wrong i dont think itll all be smooth but a new science is being born we are manipulating cells at a level that we havent before were building artificial pancreases and artificial hearts the first time blood was transfused from one person to another this was in the 1800s people thought the person who emerged would be a different human being theyd acquire the psyche of the other human blood was thought to be so important to your soul it was who you were and then blood was transferred from one human to another and nothing happened when it was matched properly but the person who emerged clearly carried at least some part of another human being within themselvesp pso i use the term new human very provocatively in the first chapter i say weve started thinking of new human as some kind of science fiction character but the new human im talking about is one whose units are built new but who might look like you and me if someone receives a blood transfusion that person is two people in one in some ways for a long time philosophers thought about human beings emin totoem you were you and that was the end now weve started building humans with cells or organs from other places parts that may be enhanced or genetically altered and yet we still take you as you i think thats a very interesting conundrump

pwhen harvardtrained physician pulitzer prizewinning author siddhartha mukherjee talks new human doesnt mean keanu reeves black muumuu writes new book song cell exploration medicine new human instead mukherjees new human like paradoxical ship theseus time vessels original planks removed replaced new wood human rebuilt way healthy replacements aging malfunctioning cells human new onep pin song cell set published week mukherjee explores questions stories life efforts diagnose save patients including barely survives literal bloodbath battle stubborn depression pandemic fathers death talked experiences research book conversation gazette interview edited clarity lengthp h2qampah2 h3siddhartha mukherjeeh3 pspangazettespanthroughout book reference historical scientific figures poets philosophers going far aristotle ancient ideas help understand modern medicinep pspanmukherjeespanits forgotten aristotle probably biologist philosopher distinction natural scientist philosopher blurrier today people like aristotle questions like come questions natural sciences philosophyp pspangazettespanmany stories include medical failures attempts find cures didnt right like example physician tried cure patients psychiatric symptoms infusion cows blood recently bonemarrow transplantsp pspanmukherjeespanin principle emcantem human beings transfused cows blood looks similar microscope cows blood thats different human blood failures ways beginnings successful journeys showcase science human endeavor thats flaws mistakes misunderstand things misunderstand otherp pi impromptu meeting nurses worked bonemarrow transplants spontaneously started talking massive litany failures cried hugged remembered little boy bunker pilot fogged plutonium died leukemia started talking successes story stuck mep pspangazettespanyou dedicate chapter pandemic exposed deep fundamental shortcomings knowledge biology system thought knewp pspanmukherjeespanin sciences point develop kind hubris walks kind hubris newtonian mechanics understanding electricity magnetism atomic structure suddenly people realized deeper areas known didnt compute pandemic demanded kind reevaluation dont know immune system covid impacts immune system intestines respiratory systems things thought understood deep level reevaluated context virus viruses come itp pspangazettespanin books chapter talk understanding cellular songs individual cells work like orchestra important frontier explorep pspanmukherjeespanto understand build organism ultimately need understand communications individual parts organism beginning understand parts sum parts communications organisms cellular ecology example comes mind famous conundrum cancer metastases arent metastases spleen liver frequent site metastasis anatomy ecology cells ill example frequent metastases whats called axial skeleton central skeleton distal skeleton fingers bones body answer answers understanding anatomy cells communicate case cancer cells build homes thats mysteries need understand thats book called song cellp pspangazettespanyou introduce idea new human built simply born today fear kind cellular manipulation caution people fearp pspanmukherjeespani like cautioning people fear im blithe reservations ive seen bone marrow transplants horribly wrong dont think itll smooth new science born manipulating cells level havent building artificial pancreases artificial hearts time blood transfused person 1800s people thought person emerged different human theyd acquire psyche human blood thought important soul blood transferred human happened matched properly person emerged clearly carried human themselvesp pso use term new human provocatively chapter weve started thinking new human kind science fiction character new human im talking units built new look like receives blood transfusion person people ways long time philosophers thought human beings emin totoem end weve started building humans cells organs places parts enhanced genetically altered think thats interesting conundrump

6351ccea04ab371b37888745

San Francisco fact of the day

blockquotepthe city of san francisco is upping its toilet game and is prepared to spend up to 17 million to build a single commode in one neighborhood plazap pcity leaders are slated to gather wednesday afternoon at the noe valley town square to officially announce a 17 million state budget win to build a toilet there according to an a datav9y1 dataylkslkonline event schedule datarapid_p7 relnofollow noopener hrefhttpsnoevalleytownsquarecomevents target_blankonline event schedulea the proposed facility would include just one toilet in a 150foot space according to a new report by a datav9y1 dataylkslksan francisco chronicle datarapid_p8 relnofollow noopener hrefhttpsarchiveph3zq8gselection3797953797105 target_blankemsan francisco chronicleema columnist heather knightp pthe citys recreation and parks department and the department of public works which will work together to build the pricey potty expect it will take three years to completepblockquote phere is a relnoopener hrefhttpsnewsyahoocomflushingmoneysanfranciscospend154446848html target_blankthe full storya via fernandp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210sanfranciscofactoftheday3htmlsan francisco fact of the daya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

blockquotepthe city san francisco upping toilet game prepared spend 17 million build single commode neighborhood plazap pcity leaders slated gather wednesday afternoon noe valley town square officially announce 17 million state budget win build toilet according ana datav9y1 dataylkslkonline event schedule datarapid_p7 relnofollow noopener hrefhttpsnoevalleytownsquarecomevents target_blankonline event schedulea proposed facility include toilet 150foot space according new report bya datav9y1 dataylkslksan francisco chronicle datarapid_p8 relnofollow noopener hrefhttpsarchiveph3zq8gselection3797953797105 target_blankemsan francisco chronicleemacolumnist heather knightp pthe citys recreation parks department department public works work build pricey potty expect years completepblockquote phere relnoopener hrefhttpsnewsyahoocomflushingmoneysanfranciscospend154446848html target_blankthe storya fernandp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210sanfranciscofactoftheday3htmlsan francisco fact daya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6351cd0d04ab371b3788874b

The Critical Turn in Education

h4the marxification of education workshop session 1 of 4h4 peducation has been stolen from us and from our children yes istoleni it was deliberately transformed from within into something that is barely education at all anymore instead its a systematic program of thought reform brainwashing into neomarxist belief and activism how has this been accomplished the formal name for the transformation is the critical turn in education which turned education from traditional models of pedagogy to critical pedagogy the application and teaching of critical theory to and through the education system its purpose to overcome what marxists refer to as the problem of reproduction by which stable societies reproduce themselves from one generation to the next especially through institutions involving children like religion family media and especially education here new discourses founder james lindsay summarizes this turn in this first of four presentations on the marxification of education delivered in late july 2022 in arlington virginia on location in the nowfamous loudoun county ground zero for the fight for americas schoolsp pas a result of the research that produced this lecture series lindsay has written a detailed and accessible book on the issue titled a relnoopener hrefhttpsamznto3ryz0ty target_blankithe marxification of educationia which is available for preorder nowp hr pemthe audio version of this presentation is available on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pthe post a relnofollow hrefhttpsnewdiscoursescom202210thecriticalturnineducationthe critical turn in educationa appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap

h4the marxification education workshop session 1 4h4 peducation stolen children yesistoleni deliberately transformed barely education anymore instead systematic program thought reform brainwashing neomarxist belief activism accomplished formal transformation critical turn education turned education traditional models pedagogy critical pedagogy application teaching critical theory education system purpose overcome marxists refer problem reproduction stable societies reproduce generation especially institutions involving children likereligion family media especially education new discourses founder james lindsay summarizes turn presentations marxification education delivered late july 2022 arlington virginia location nowfamous loudoun county groundzero fight americas schoolsp pas result research produced lecture series lindsay written detailed accessible book issue titleda relnoopener hrefhttpsamznto3ryz0ty target_blankithe marxification educationia available preorder nowp hr pemthe audio version presentation available spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202210thecriticalturnineducationthe critical turn educationa appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap

6351cd9304ab371b37888761

What will stop Vladimir Putin?

pcalls for negotiations to end russias war with ukraine tend to be directed more at kyiv or washington than moscow as if it were the former two that were the main stumbling blocks to peace yet it is a relnoopener hrefhttpswwwnewstatesmancomtagvladimirputin target_blankvladimir putina that is demanding that this war leads to a fundamental change in borders and political arrangements which he has no right on any reading of international law to demand putin does not preclude talks but only so long as russia is allowed to hold on to occupied territory even territory from which it has had to retreat the ukrainian president a relnoopener hrefhttpswwwnewstatesmancomtagvolodymyrzelensky target_blankvolodymyr zelenskya demands withdrawal and while at the start of war he might have been ready to go back to the position of 23 february 2022 he now expects to return to the borders of eight years ago before russia annexed crimeap pthe problem is not just that this demands gap looks for the moment to be unbridgeable but also that putin has so far refused to scale down his demands to match his diminished position his past duplicity undermines any confidence ukraine might have that a deal once reached would be honoured not only are the two sets of demands incompatible but there is no trust there are any number of proposals around describing deals that might end the war as if this was equivalent to a business transaction that could be settled with a handshake ending this war in a way that leads to as stable a relationship that is possible between these two countries after one has been viciously attacked and the other humiliated in battle will require addressing issues that would be complex under the best of circumstances and these are the worstp pthose who urge a deal based on mutual concessions that has any chance of being turned into treaty language need to recognise that this will not stop the war in short order because nothing can be agreed or even implemented in short order we need to think in terms of a twostage process and possibly more this requires separating the fundamental territorial issue which is now the main driver of the fighting from all the other consequential issues that will have to be addressed in a proper peace process when we get to that stage the main factor influencing the process may well be the sanctions imposed by the west and this will therefore require a direct role for the us eu uk and other interested parties the first stage may well require mediation and devices such as international observers and even peacekeepers but it will need to be kept as simple as possible if it is to be linked to a ceasefirep h4the early negotiationsh4 pin a recent press conference after a meeting of the collective security treaty organisation csto military alliance in kazakhstan putin answered a question on negotiations first he acknowledged that he was being pressed by india and china on the importance of dialogue and peaceful resolution while respecting their position as our close allies and partners he also commented on kyivs position [t]hey kept saying they wanted talks and even sort of asked for them but have now passed an official decision that bans such talks well what is there to discussp phe also repeated a claim that has become something of a theme of russian propaganda on the subject of negotiations we have always said that we are open we reached certain agreements in istanbul after all these agreements were almost initialed but as soon as our troops withdrew from kyiv the kyiv authorities lost any interest in the talks that is all there is to itp pthis claim needs examining not only because it is relevant to the question of who is to blame for the failure of negotiations thus far more importantly it can also help us understand some of the issues that would emerge should negotiations resumep pdirect talks between ukraine and russia began a couple of days after the a relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine target_blankrussian invasiona the gap in objectives was soon evident russia claimed that it was ready to stop its military campaign in a moment but that would require not only that ukraine halt hostilities but also acknowledge crimea as russian territory accept donetsk and luhansk as independent states and change its constitution to preclude entry into nato or the european union the demands for ukraines demilitarisation and denazification were never quite withdrawnp pduring this early period it is clear that zelensky assumed the main concession needed by putin was a promise not to join nato on 8 march when explaining that he was ready for dialogue zelensky explained that i have cooled down regarding this question a long time ago after we understood that nato is not prepared to accept ukraine the alliance is afraid of controversial things and confrontation with russiap phe also sounded conciliatory on the question of donetsk and luhansk i think that items regarding temporarily occupied territories and pseudorepublics not recognised by anyone but russia we can discuss and find a compromise on how these territories will live on whats important to me is how the people in those territories who want to be part of ukraine are going to live when it came to a relnoopener nofollow hrefhttpswwwpresidentgovuaennewsukrayinapovinnamatikolektivnijdogovirbezpekizivsimas73433 target_blankcrimeaa he added that he could not recognise it as the territory of russia but that it will be difficult for russia to recognise that this is the territory of ukraine this implied some form of joint sovereignty or shared citizenshipp pthe first highlevel meeting between the two foreign ministers ukraines dmytro kuleba and russias sergei lavrov took place in turkey on 10 march kuleba described the russian proposals for ending the war as a demand for surrender nonetheless the ukrainians including zelensky began to sound more hopeful noting that russia had moved away from ultimatums there was then a brief moment of optimism with stories in a number of newspapers such as the emfinancial timesem about a 15point peace plan the aim appeared to be to draft a document for zelensky and putin to signp pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine202210irantestsoutitsdeadlyweaponsonukraine target_blankiran tests out its deadly weapons on ukrainea]emstrongp pthe core deal put a ceasefire and full russian withdrawal at the price of ukraine abandoning plans to join nato although the ukrainian side of this deal appeared to be more developed than the russian zelensky repeated on 15 march his previous point it is clear that ukraine is not a member of nato we understand this for years we heard about the apparently open door but have already also heard that we will not enter there and these are truths and must be acknowledgedp ptellingly and contrary to claims that he opposed the potential deal the then uk prime minister boris johnson one of ukraines strongest supporters in nato observed that everybody has always said and weve made it clear to putin theres no way ukraine is going to join nato anytime soon but the decision about the future of ukraine has got to be for the ukrainian peoplep pthe concession from russia was apparently that neutrality while precluding membership of nato and foreign bases would not require full demilitarisation nonetheless the ukrainians also wanted security guarantees from other foreign states to prevent attacks on ukraine these might not come from nato and instead from a pool of allies but it would still offer the main benefit of nato security guarantees without actual membershipp pone problematic aspect of these discussions was that while russian withdrawal was envisaged it was not clear how if at all this would include luhansk and donetsk and most importantly whether this would be integral to any deal or could be taken as a separate matter for discussion once a ceasefire was in placep ppart of the optimism then in addition to the assumption that nato really was the big issue for russia was that russian forces would be obliged to leave ukrainian territory soon anyway because ukrainian forces were fighting back so effectively russia had failed to take any cities was suffering heavy losses in equipment and personnel and was experiencing unexpectedly severe economic sanctionsp pthe optimism did not last long the regular talks failed to make progress zelensky proposed direct talks with putin to end the war lavrov said the two sides would need to be much closer to a settlement before there could be direct talks moreover there would be procedural issues even if a deal could be reached on neutrality any security guarantees once agreed would need to be ratified by the guarantors parliaments in addition zelensky promised that any deal would be put to a referendum if agreed it could take up to a year before ukraines constitution could be amendedp pit soon became apparent that ukraine needed to sort out the big territorial questions as part of any deal once a ceasefire had been agreed there would be few incentives in moscow to discuss the return of any newly occupied territory the russians were also pushing for agreements on restoring crimeas water supply pledging not to try to retake the peninsula by force and the protection of the russian language in ukraine all of this would add to the complexity of any negotiations and the time required for implementationp pdespite the russian ministry of defences announcement at the end of march that it would be leaving the area around kyiv and elsewhere in the north as a goodwill gesture to support the peace talks as opposed to a concession to military realities the ukrainians were now disillusioned with the effort their chief negotiator mykhailo podolyak wrote that any agreement with russia isnt worth a broken penny is it possible to negotiate with a country that always lies cynically and propagandistically zelensky said the only person worth talking to was putin since he made all the decisions it doesnt matter what their foreign minister says it doesnt matter that he sends some negotiating group to us all these people are nobodies unfortunately discussions continued with russia conceding that it was no longer demanding denazification though only russia thought that ukraine was nazified and allowing membership of the eup pwhen it came to a treaty on neutrality and security guarantees the russians lost interest when the ukrainians brought forward their own draft which diverged significantly from the one they had tabled by midmay the talks were effectively over lavrov now claimed that the west was using the conflict for its purposes and did not want it to end more to the point ukrainian attitudes were being reshaped and hardened by russias brutal conduct of the war and the evidence of war crimes revealed by the liberation of areas previously occupied by russian forces near kyiv russias focus on taking all of donbas and not just the two annexed territories highlighted the territorial issues on 25 may zelensky stressed that ukrainians are not ready to accept that their land belongs to russiap pwhat can we conclude from these early talks first the reason why the talks failed was not simply because kyiv abandoned a deal close to signature but because the territorial issues had not been resolved and russias conduct of the war made ukraine determined to liberate all occupied areasp psecond the ideas canvassed at this time to address some of the issues at the heart of the war might still be relevant those on neutrality and security guarantees were the most mature but these reflected a misapprehension that the only thing that really mattered to putin was keeping ukraine out of nato and his objectives in ukraine were in some way secondary there were ideas from kyiv on ways to enable those living in ukrainian territory to identify as russian if they so wished but they were less developed and evinced no interest from russia though they might become relevant in the futurep pthird even were these issues addressed in good faith they could not be settled quickly and any agreements would take a long time to implement a full peace negotiation would not necessarily be a quick route to end the fightingp h4discussions about discussionsh4 pas it has become clearer that russia had embarked on a war of conquest it has become even harder to imagine a negotiated solution if the endstate is to be based on territorial holdings when the fighting stops both sides have an incentive to keep fighting putin has never claimed to be abandoning talks but at all times his terms suppose that he would be negotiating from a position of strength which he would expect ukraine to recognisep pthe news outlet emmeduzaem run by russian journalists now working out of riga has published a relnoopener nofollow hrefhttpsmeduzaioenfeature20221014whyrussiaispushingareturntonegotiationsutm_sourceemailutm_mediumbrieflyutm_campaign20221015 target_blankinteresting worka on the current thinking about negotiations in both moscow and kyivp pthe line taken by russians in meetings with foreigners as with putin at the csto is that they are ready to talk but only if their conditions are met on 6 october the russian federation council speaker valentina matvienko proposed inviting ukraines delegation to a preparatory meeting for novembers g20 summit and that the two countries begin peace negotiations today she urged that the two sides should try to understand each other find an agreement later however she made it clear that she was not expecting to discuss russias annexation of ukraines occupied territories adding were willing to put an end to further military action in ukraine but on the terms offered by russiap pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine202210willputingonuclearthreatukraine target_blankwill putin go nucleara]emstrongp pthere have been reports that moscow is encouraging the turkish president recep tayyip erdoan to convince ukraine to return to negotiations with russia most intriguingly there has been the socalled elon musk plan proposed by the tesla billionaire and short enough to fit into a tweetp p1 redo elections of annexed regions under un supervision russia leaves if that is the will of the peoplebr2 crimea formally part of russia as it has been since 1783 until khrushchevs mistakebr3 water supply to crimea assuredbr4 ukraine remains neutralp pit has been alleged that musk proposed these ideas after speaking with putin although this has been denied the russia expert fiona hill has reported that musk was trying these ideas out at various forums during septemberp pthe last three points fit with past russian demands and reflects their case for holding on to southern ukraine in addition to the donbas the idea of redoing the referendums of the annexed regions is something of a joke given the sham way they were conducted in the first place it is hard to see how they could be conducted reliably whatever the un role while the russians were still in occupation and depopulating the areas and also fighting to hold on to them if they were conducted after withdrawal russia would soon lose interestp pthe ukrainian view now is that any discussions on postwar coexistence depend on russia completely withdrawing troops from all the territory of ukraine including the annexed regions and crimea the defence minister oleksii reznikov has acknowledged that this is different from ukraines march position when it was only asking for a return to the positions of 23 february back then it was possible but now they have passed more than one point of no return and this option has long been impossible zelensky now refuses to negotiate with putin only with his replacement the feeling is mutual putin does not want to grant zelensky any legitimacy or status by meeting with himp pall this confirms the conclusion from the earlier talks that even under more propitious conditions there is no obvious basis for a peace settlement and that any attempt to negotiate one will be prolonged and difficult and not provide a quick way to end the fightingp h4ceasefires and disengagementh4 pan alternative approach to a full peace settlement has always been to agree to a ceasefire this would mean postponing full talks that might lead to a durable settlement these could then be undertaken under less pressure and without one eye always on what is happening in the battle emmeduzaem reports that the kremlin has been considering a scenario in which instead of a fullfledged peace treaty ukraine is persuaded to agree to a temporary ceasefire russias leaders believe this could be arranged through negotiations between russian and ukrainian troops without the involvement of either countrys president a relnoopener nofollow hrefhttpsmeduzaioenfeature20221014whyrussiaispushingareturntonegotiations target_blankthe report readsap pit goes on to note that putin sees the main benefit of this not as a means of ending the war but as part of a strategy to buy time for training conscripts and replenishing supplies in order to launch a fullscale offensive in february or march unsurprisingly because this thought has also occurred to kyiv ukraine rejects such proposals as a snare and a delusion podolyak is quoted as saying in that same emmeduzaem article what does a ceasefire give ukraine in the russian scenario a chance to fix a de facto new line of separation and hastily dig up russians in the temporarily occupied territories can they really believe were going to agree to that especially against the backdrop of the counteroffensivep pa clear operational pause for the brutally battered russian units so they can at least train a few hastily mobilised soldiers and send a new quantity of deathbound men to the battlefield what would we want that forp ppodolyak believes the main ukrainian interest now is in defeating russia militarily because thats the only thing that will allow us to truly end the war gain the opportunity to brutally punish the war criminals through legal channels and indirectly facilitate the launch of a scenario in which the russian political system of russia itself is transformedp pall this explains why ukraine is unlikely to agree to a ceasefire at the very least it would allow russia to freeze the existing lines of contact and continue with its occupation a truce would allow it to prepare for the next stage of the warp pone thing that might change ukrainian attitudes could be greater russian success in holding defensive lines and preventing further retreats but even assuming continued military success for ukraine kyiv needs to develop its own scenario for ending the war if russia pushes for a ceasefire under any circumstances including the fear that it will be pushed back even further there will be many in the west eager for ukraine to acceptp pukraines best response to proposals for immediate ceasefires is not to dismiss them out of hand but to agree that it will ceasefire while russian forces withdraw back to internationally recognised borders and that all attacks on ukrainian cities and infrastructure stop this could be conducted in principle on a militarytomilitary basis without putin and zelensky being directly involved when they are unwilling to talk to each other but also enabling them to reserve their positions on the form that a longterm settlement might takep peven if this approach was accepted in principle which probably requires that the russian high command realises that it is facing an even more calamitous defeat this is still not necessarily something that could be agreed easily or quickly just more easily and quickly than a full peace settlement what is decided at this point would have implications for any future deal the largest and most obvious issue is crimea there would also be questions about whether this was a disengagement agreement which might be easier for russia to accept if it meant that ukrainian forces would not move into the land that russian forces were leaving the ukrainians would be worried that this would leave local people feeling unsafe and uncared for and also that evidence of war crimes would be lost it would also require a un force or something equivalent to move in there would also be issues about prisoner swaps which have loomed large in past armistices although a number of these have already been implemented and more difficult the fate of the many residents including children that the ukrainians believe have been taken from occupied territoriesp pthe next stage would be a proper peace settlement which would need to define the border between the two countries agree the status of crimea possibly offer measures to deal with residents of ukraine who might identify more as russians far fewer now than before considers questions of neutrality and security and address issues of reparations and war crimes the point about this stage is that other parties would need to be involved simply because it is hard to see how moscow could agree to much while the many layers of sanctions were still in place these layers could only be removed with confidence as agreements were being fully implemented just stating a possible agenda illustrates the problems facing a conference intended to produce a durable peacep pand that is before the putin question the one with which we always seem to end so long as he remains in power can there be a serious negotiation at all and will the us uk and eu feel that they can lift sanctions the concessions required would probably be too much for putin to accept but would that mean russia was left economically and politically isolatedp pnone of this is predictive for how all this works out depends on future military and political developments that will shape the bargaining positions of the two sides and how they approach talks they are however all issues that are worth thinking about nowp pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancomworldeurope202210helsinkinatonuclearpowerfinlandchallengesrussia target_blankletter from helsinki finlands challenge to russiaa]emstrongp pemlawrence freedman is a regular contributor to the new statesman a version of this piece originally appeared on his substack a hrefhttpssamfsubstackcompgettingtonegotiationscomment is freedaemp

pcalls negotiations end russias war ukraine tend directed kyiv washington moscow main stumbling blocks peace relnoopener hrefhttpswwwnewstatesmancomtagvladimirputin target_blankvladimir putina demanding war leads fundamental change borders political arrangements right reading international law demand putin preclude talks long russia allowed hold occupied territory territory retreat ukrainian president relnoopener hrefhttpswwwnewstatesmancomtagvolodymyrzelensky target_blankvolodymyr zelenskya demands withdrawal start war ready position 23 february 2022 expects return borders years ago russia annexed crimeap pthe problem demands gap looks moment unbridgeable putin far refused scale demands match diminished position past duplicity undermines confidence ukraine deal reached honoured sets demands incompatible trust number proposals describing deals end war equivalent business transaction settled handshake ending war way leads stable relationship possible countries viciously attacked humiliated battle require addressing issues complex best circumstances worstp pthose urge deal based mutual concessions chance turned treaty language need recognise stop war short order agreed implemented short order need think terms twostage process possibly requires separating fundamental territorial issue main driver fighting consequential issues addressed proper peace process stage main factor influencing process sanctions imposed west require direct role eu uk interested parties stage require mediation devices international observers peacekeepers need kept simple possible linked ceasefirep h4the early negotiationsh4 pin recent press conference meeting collective security treaty organisation csto military alliance kazakhstan putin answered question negotiations acknowledged pressed india china importance dialogue peaceful resolution respecting position close allies partners commented kyivs position [t]hey kept saying wanted talks sort asked passed official decision bans talks discussp phe repeated claim theme russian propaganda subject negotiations said open reached certain agreements istanbul agreements initialed soon troops withdrew kyiv kyiv authorities lost interest talks itp pthis claim needs examining relevant question blame failure negotiations far importantly help understand issues emerge negotiations resumep pdirect talks ukraine russia began couple days relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine target_blankrussian invasiona gap objectives soon evident russia claimed ready stop military campaign moment require ukraine halt hostilities acknowledge crimea russian territory accept donetsk luhansk independent states change constitution preclude entry nato european union demands ukraines demilitarisation denazification withdrawnp pduring early period clear zelensky assumed main concession needed putin promise join nato 8 march explaining ready dialogue zelensky explained cooled question long time ago understood nato prepared accept ukraine alliance afraid controversial things confrontation russiap phe sounded conciliatory question donetsk luhansk think items temporarily occupied territories pseudorepublics recognised russia discuss find compromise territories live whats important people territories want ukraine going live came relnoopener nofollow hrefhttpswwwpresidentgovuaennewsukrayinapovinnamatikolektivnijdogovirbezpekizivsimas73433 target_blankcrimeaahe added recognise territory russia difficult russia recognise territory ukraine implied form joint sovereignty shared citizenshipp pthe highlevel meeting foreign ministers ukraines dmytro kuleba russias sergei lavrov took place turkey 10 march kuleba described russian proposals ending war demand surrender nonetheless ukrainians including zelensky began sound hopeful noting russia moved away ultimatums brief moment optimism stories number newspapers emfinancial timesem 15point peace plan aim appeared draft document zelensky putin signp pstrongem[see relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine202210irantestsoutitsdeadlyweaponsonukraine target_blankiran tests deadly weapons ukrainea]emstrongp pthe core deal ceasefire russian withdrawal price ukraine abandoning plans join nato ukrainian deal appeared developed russian zelensky repeated 15 march previous point clear ukraine member nato understand years heard apparently open door heard enter truths acknowledgedp ptellingly contrary claims opposed potential deal uk prime minister boris johnson ukraines strongest supporters nato observed everybody said weve clear putin theres way ukraine going join nato anytime soon decision future ukraine got ukrainian peoplep pthe concession russia apparently neutrality precluding membership nato foreign bases require demilitarisation nonetheless ukrainians wanted security guarantees foreign states prevent attacks ukraine come nato instead pool allies offer main benefit nato security guarantees actual membershipp pone problematic aspect discussions russian withdrawal envisaged clear include luhansk donetsk importantly integral deal taken separate matter discussion ceasefire placep ppart optimism addition assumption nato big issue russia russian forces obliged leave ukrainian territory soon ukrainian forces fighting effectively russia failed cities suffering heavy losses equipment personnel experiencing unexpectedly severe economic sanctionsp pthe optimism long regular talks failed progress zelensky proposed direct talks putin end war lavrovsaid sides need closer settlement direct talks procedural issues deal reached neutrality security guarantees agreed need ratified guarantors parliaments addition zelensky promised deal referendum agreed year ukraines constitution amendedp pit soon apparent ukraine needed sort big territorial questions deal ceasefire agreed incentives moscow discuss return newly occupied territory russians pushing agreements restoring crimeas water supply pledging try retake peninsula force protection russian language ukraine add complexity negotiations time required implementationp pdespite russian ministry defences announcement end march leaving area kyiv north goodwill gesture support peace talks opposed concession military realities ukrainians disillusioned effort chief negotiator mykhailo podolyak wrote agreement russia isnt worth broken penny possible negotiate country lies cynically propagandistically zelensky said person worth talking putin decisions doesnt matter foreign minister says doesnt matter sends negotiating group people nobodies unfortunately discussions continued russia conceding longer demanding denazification russia thought ukraine nazified allowing membership eup pwhen came treaty neutrality security guarantees russians lost interest ukrainians brought forward draft diverged significantly tabled midmay talks effectively lavrov claimed west conflict purposes want end point ukrainian attitudes reshaped hardened russias brutal conduct war evidence war crimes revealed liberation areas previously occupied russian forces near kyiv russias focus taking donbas annexed territories highlighted territorial issues 25 zelensky stressed ukrainians ready accept land belongs russiap pwhat conclude early talks reason talks failed simply kyiv abandoned deal close signature territorial issues resolved russias conduct war ukraine determined liberate occupied areasp psecond ideas canvassed time address issues heart war relevant neutrality security guarantees mature reflected misapprehension thing mattered putin keeping ukraine nato objectives ukraine way secondary ideas kyiv ways enable living ukrainian territory identify russian wished developed evinced interest russia relevant futurep pthird issues addressed good faith settled quickly agreements long time implement peace negotiation necessarily quick route end fightingp h4discussions discussionsh4 pas clearer russia embarked war conquest harder imagine negotiated solution endstate based territorial holdings fighting stops sides incentive fighting putin claimed abandoning talks times terms suppose negotiating position strength expect ukraine recognisep pthe news outlet emmeduzaem run russian journalists working riga published relnoopener nofollow hrefhttpsmeduzaioenfeature20221014whyrussiaispushingareturntonegotiationsutm_sourceemailutm_mediumbrieflyutm_campaign20221015 target_blankinteresting worka current thinking negotiations moscow kyivp pthe line taken russians meetings foreigners putin csto ready talk conditions met 6 october russian federation council speaker valentina matvienko proposed inviting ukraines delegation preparatory meeting novembers g20 summit countries begin peace negotiations today urged sides try understand find agreement later clear expecting discuss russias annexation ukraines occupied territories adding willing end military action ukraine terms offered russiap pstrongem[see relnoopener hrefhttpswwwnewstatesmancomworldeuropeukraine202210willputingonuclearthreatukraine target_blankwill putin nucleara]emstrongp pthere reports moscow encouraging turkish president recep tayyip erdoan convince ukraine return negotiations russiamost intriguingly socalled elon musk plan proposed tesla billionaire short fit tweetp p1 redo elections annexed regions un supervision russia leaves peoplebr2 crimea formally russia 1783 khrushchevs mistakebr3 water supply crimea assuredbr4 ukraine remains neutralp pit alleged musk proposed ideas speaking putin denied russia expert fiona hill reported musk trying ideas forums septemberp pthe points fit past russian demands reflects case holding southern ukraine addition donbas idea redoing referendums annexed regions joke given sham way conducted place hard conducted reliably un role russians occupation depopulating areas fighting hold conducted withdrawal russia soon lose interestp pthe ukrainian view discussions postwar coexistence depend russia completely withdrawing troops territory ukraine including annexed regions crimea defence minister oleksii reznikov acknowledged different ukraines march position asking return positions 23 february possible passed point return option long impossible zelensky refuses negotiate putin replacement feeling mutual putin want grant zelensky legitimacy status meeting himp pall confirms conclusion earlier talks propitious conditions obvious basis peace settlement attempt negotiate prolonged difficult provide quick way end fightingp h4ceasefires disengagementh4 pan alternative approach peace settlement agree ceasefire mean postponing talks lead durable settlement undertaken pressure eye happening battle emmeduzaem reports kremlin considering scenario instead fullfledged peace treaty ukraine persuaded agree temporary ceasefire russias leaders believe arranged negotiations russian ukrainian troops involvement countrys president relnoopener nofollow hrefhttpsmeduzaioenfeature20221014whyrussiaispushingareturntonegotiations target_blankthe report readsap pit goes note putin sees main benefit means ending war strategy buy time training conscripts replenishing supplies order launch fullscale offensive february march unsurprisingly thought occurred kyiv ukraine rejects proposals snare delusion podolyak quoted saying emmeduzaem article ceasefire ukraine russian scenario chance fix de facto new line separation hastily dig russians temporarily occupied territories believe going agree especially backdrop counteroffensivep pa clear operational pause brutally battered russian units train hastily mobilised soldiers send new quantity deathbound men battlefield want forp ppodolyak believes main ukrainian interest defeating russia militarily thats thing allow truly end war gain opportunity brutally punish war criminals legal channels indirectly facilitate launch scenario russian political system russia transformedp pall explains ukraine unlikely agree ceasefire allow russia freeze existing lines contact continue occupation truce allow prepare stage warp pone thing change ukrainian attitudes greater russian success holding defensive lines preventing retreats assuming continued military success ukraine kyiv needs develop scenario ending war russia pushes ceasefire circumstances including fear pushed west eager ukraine acceptp pukraines best response proposals immediate ceasefires dismiss hand agree ceasefire russian forces withdraw internationally recognised borders attacks ukrainian cities infrastructure stopthis conducted principle militarytomilitary basis putin zelensky directly involved unwilling talk enabling reserve positions form longterm settlement takep peven approach accepted principle probably requires russian high command realises facing calamitous defeat necessarily agreed easily quickly easily quickly peace settlement decided point implications future deal largest obvious issue crimea questions disengagement agreement easier russia accept meant ukrainian forces land russian forces leaving ukrainians worried leave local people feeling unsafe uncared evidence war crimes lost require un force equivalent issues prisoner swaps loomed large past armistices number implemented difficult fate residents including children ukrainians believe taken occupied territoriesp pthe stage proper peace settlement need define border countries agree status crimea possibly offer measures deal residents ukraine identify russians far fewer considers questions neutrality security address issues reparations war crimes point stage parties need involved simply hard moscow agree layers sanctions place layers removed confidence agreements fully implemented stating possible agenda illustrates problems facing conference intended produce durable peacep pand putin question end long remains power negotiation uk eu feel lift sanctions concessions required probably putin accept mean russia left economically politically isolatedp pnone predictive works depends future military political developments shape bargaining positions sides approach talks issues worth thinking nowp pstrongem[see relnoopener hrefhttpswwwnewstatesmancomworldeurope202210helsinkinatonuclearpowerfinlandchallengesrussia target_blankletter helsinki finlands challenge russiaa]emstrongp pemlawrence freedman regular contributor new statesman version piece originally appeared substack hrefhttpssamfsubstackcompgettingtonegotiationscomment freedaemp

6351cded04ab371b3788876b

Biden recommits to close US-UK cooperation in response to Truss resignation

ppresident biden on thursday reiterated his commitment to close cooperation between the united states and united kingdom in response to the resignation of british prime minister liz trussp pthe united states and the united kingdom are strong allies and enduring friends and that fact will never change he said in a statementp ptruss a hrefhttpsthehillcominternational3696824britishprimeministerliztrussresignsresigned on thursdaya after her policies triggered further economic turmoil in the uk a leadership election to decide the next prime minister will be held within the weekp pwhen asked later by reporters if truss did the right thing biden said well thats for her to decidep pbut look she was a great partner on russia and on ukraine and the british are going to solve their problems he added but she was a good partnerp pbiden thanked truss in his statement for her partnership on a range of issues including holding russia accountable for its war against ukraine p pwe will continue our close cooperation with the uk government as we work together to meet the global challenges our nations face the president saidp ptruss will become the shortestserving prime minister in british history she was appointed by the late queen elizabeth ii on sept 6 just days before the monarchs death and spoke to king charles iii on thursday to notify him of her resignationp pjust a month ago biden met with truss in person at the united national general assembly in new yorkp pthe president in that meeting reiterated his commitment to the uks peace agreement with northern ireland truss has backed a proposal that critics say would unwind parts of the deal that ended the northern ireland conflict p pthe uks exit from the european union sparked renewed concerns about the possibility of a hard border between northern ireland and ireland which would upset the agreementp palso in that bilateral meeting the two discussed the economic relationship between the us and uk as well as energy and economy security for britain and the war in ukraine p pbiden attended the queens funeral in london days before the new york meeting which truss thanked him forp pemupdated 1138 amemp

ppresident biden thursday reiterated commitment close cooperation united states united kingdom response resignation british prime minister liz trussp pthe united states united kingdom strong allies enduring friends fact change said statementp ptrussa hrefhttpsthehillcominternational3696824britishprimeministerliztrussresignsresignedon thursdaya policies triggered economic turmoil uk leadership election decide prime minister held weekp pwhen asked later reporters truss right thing biden saidwell thats decidep pbut look great partner russia ukraine british going solve problems added good partnerp pbiden thanked truss statement partnership range issues including holding russia accountable war ukrainep pwe continue close cooperation uk government work meet global challenges nations face president saidp ptruss shortestserving prime minister british history appointed late queen elizabeth ii sept 6 days monarchs death spoke king charles iii thursday notify resignationp pjust month ago biden met truss person united national general assembly new yorkp pthe president meeting reiterated commitment uks peace agreement northern ireland truss backed proposal critics unwind parts deal ended northern ireland conflict p pthe uks exit european union sparked renewed concerns possibility hard border northern ireland ireland upset agreementp palso bilateral meeting discussed economic relationship uk energy economy security britain war ukrainep pbiden attended queens funeral london days new york meeting truss thanked forp pemupdated 1138 amemp

6351cdf604ab371b3788876d

Entrepreneurs are more altruistic than ever – but how can we help them make good on their ambitions?

pspanyoung and old people have different opinions and tastes on everything from fashion to politics that might sound truistic but it really matters if were trying to work out what the future might look like when todays twentysomethings are running our major institutions spanspanthis is especially true when looking at the entrepreneurs and innovators who spanspanwill have an outsized impact on how we live and workspanp pspanso we at the enterpreneurs network teamed up with youth business international to ask a simple question spanstronga hrefhttpsstatic1squarespacecomstatic58ed40453a04116f46e8d99bt6345e3c59456801f388d3a9a1665524760083tomorrows_entrepreneurspdfwhat do young entrepreneurs thinkastrongspan how are they different from older entrepreneurs and what can we do to best support themspanp pspanour main finding is that young entrepreneurs here defined as those under 35  are more altruistic than older entrepreneurs they are twice as likely 39 vs 18 to say that their business primary aim is to solve a social or environmental problem interestingly that figure actually rises to spanspan47 for the most successful entrepreneurs founders of businesses with a turnover of over 1m spanp pspanit is unclear whether this is because young people of every generation are genuinely more altruistic and that altruism is something they grow out of or if this generation is actually more generoushearted than its predecessors i suspect both are true spanstronga relnoopener hrefhttpswwwfrontiersinorgarticles103389fpsyg201901915full target_blankevidence suggests that adolescentsastrong are more sensitive to social pressure than children or adults and perhaps spanthat young entrepreneurs in their early twenties will be less agreeable and more antisocial when they are older but it is also clearly true that as todays young people have aged we have seen a rise in prosocial business practices and an increasing focus on esg metrics and bcorp accreditation spanp pa hrefhttpsodiorgenpressworldswealthiestincreasinglyputtingnationalinterestbeforealtruismwhenallocatingaidspanstrongsome theoristsstrongspanaspan suggest that people in wealthier countries hold more universalist ideas and that as your society becomes richer the people expand their moral circles to include people outside of their country animals and the broader environment if this is true then it makes sense that young people are more altruistic the past was a much poorer country after all spanstronga hrefhttpswwwmacrotrendsnetcountriesgbrunitedkingdomgdppercapitagdp per capitaastrong in the year 2000 was about 10 times higher than it was in the 1970sspan meaning that young people today were born into a world much wealthier than the world of their parents to put it in some context the difference between then and now is similar to spanstronga hrefhttpsenwikipediaorgwikilist_of_countries_by_gdp_ppp_per_capitathe gap between the uk and cambodia todayastrongspanspanp pspanif there is a concern about this outpouring of entrepreneurial altruism its that it can seem unfocussed entrepreneurs who say that the primary purpose of their business is to solve a social or environmental problem 29 are also more likely to say they choose suppliers that are good for society even if their business suffers 60 vs 37 spanispanandspanispan that they focus on promoting diversity at the expense of their business 55 vs 23 spanispanandspanispan that they have an important role to make sure their employees have wellrounded lives even if their work suffers 41 vs 23spanp pspansocially conscious businesses attract stronga relnoopener hrefhttpswwwinvestopediacomtermsiimpactinvestingasp target_blankimpact investorsastrong altruistic staff and socially conscious customers and they may be stuck having to fulfil the wants of their myriad stakeholders losing sight of their initial vision if a business is focusing on a major global challenge like trying to create nuclear cold fusion or finding a cure to diabetes it should be laserfocused on that aimspanp pspanso what can we do to support young entrepreneurs and help them tackle big global issues in our report we suggest three main policy interventions spanp pspanthe first is embracing triedandtested ways to help people of all ages start and scale businesses they need access to good networks so they can find people to mentor them collaborate with and just so they know the ins and outs of running a business the second is that we should bring back the enterprise allowance scheme which my coauthor sam dumitriu spanstronga relnoopener hrefhttpscapxcoarevampednewenterpriseallowancewoulddowondersforbusinesscreation target_blankhas written about beforeastrongspanspanp pspanthe third recommendation is what i think is most relevant to the question about enabling young entrepreneurs to solve big problems many of the issues that the world faces have solutions that are difficult to profit from say you found a safe way to remove all the excess carbon dioxide from the air you could reverse much of the damage of climate change and make the world happier and healthier and while this would make you very popular it is not clear that you would have paying customers that makes it difficult to attract the initial investment that you need to do research or build a factoryspanp pspangovernments often solve these problems for us they build roads and provide healthcare to people who cant afford it if a safe form of carbon capture were invented governments might choose to pay to use it but that is far from certain governments might simply steal the technology or hope that some other government pays instead all of which deters investmentspanp pspanone way around this problem is for governments to credibly commit to buying these technologies if they are created or award challenge prizes for their invention the uk government did this with the covid19 vaccine and nasa did something similar to find ways of supplying the international space stationspanp pspanthe advantage of challenge prizes is that they are solutionblind unlike innovate uk grants the government wouldnt need to evaluate proposals for bluesky research and decide what seems like a plausible solution instead we empower entrepreneurs to come up with ideas and then find backers in the private market who believe in their proposal its winwin for taxpayers too because the government only needs to payout if a novel solution really is foundspanp pspantodays young people are the healthiest best educated and apparently most altruistic generation on record throughout the world there are bright young minds thinking up clever solutions to the problems we see around us our role as policymakers is to give them the tools they need to deliverspanp pemstronga relnoopener hrefhttpscapxcosubscribe datasaferedirecturlhttpswwwgooglecomurlqhttpscapxcosubscribeampsourcegmailampust1666361388668000ampusgaovvaw0hmlzjrryb0jjjz6cootpr target_blankclick here to subscribe to our daily briefingastrong  the best pieces from capx and across the webemp pemcapx depends on the generosity of its readers if you value what we do please consider making a donationemp pthe post a relnofollow hrefhttpscapxcoentrepreneursaremorealtruisticthaneverbuthowcanwehelpthemmakegoodontheirambitionsentrepreneurs are more altruistic than ever but how can we help them make good on their ambitionsa appeared first on a relnofollow hrefhttpscapxcocapxap

pspanyoung old people different opinions tastes fashion politics sound truistic matters trying work future look like todays twentysomethings running major institutions spanspanthis especially true looking entrepreneurs innovators spanspanwill outsized impact live workspanp pspanso enterpreneurs network teamed youth business international ask simple question spanstronga hrefhttpsstatic1squarespacecomstatic58ed40453a04116f46e8d99bt6345e3c59456801f388d3a9a1665524760083tomorrows_entrepreneurspdfwhat young entrepreneurs thinkastrongspan different older entrepreneurs best support themspanp pspanour main finding young entrepreneurs defined 35 altruistic older entrepreneurs twice likely 39 vs 18 business primary aim solve social environmental problem interestingly figure actually rises spanspan47 successful entrepreneurs founders businesses turnover 1mspanp pspanit unclear young people generation genuinely altruistic altruism grow generation actually generoushearted predecessors suspect true spanstronga relnoopener hrefhttpswwwfrontiersinorgarticles103389fpsyg201901915full target_blankevidence suggests adolescentsastrong sensitive social pressure children adults spanthat young entrepreneurs early twenties agreeable antisocial older clearly true todays young people aged seen rise prosocial business practices increasing focus esg metrics bcorp accreditation spanp pa hrefhttpsodiorgenpressworldswealthiestincreasinglyputtingnationalinterestbeforealtruismwhenallocatingaidspanstrongsome theoristsstrongspanaspan suggest people wealthier countries hold universalist ideas society richer people expand moral circles include people outside country animals broader environment true makes sense young people altruistic past poorer country spanstronga hrefhttpswwwmacrotrendsnetcountriesgbrunitedkingdomgdppercapitagdp capitaastrong year 2000 10 times higher 1970sspan meaning young people today born world wealthier world parents context difference similar spanstronga hrefhttpsenwikipediaorgwikilist_of_countries_by_gdp_ppp_per_capitathe gap uk cambodia todayastrongspanspanp pspanif concern outpouring entrepreneurial altruism unfocussed entrepreneurs primary purpose business solve social environmental problem 29 likely choose suppliers good society business suffers 60 vs 37 spanispanandspanispan focus promoting diversity expense business 55 vs 23 spanispanandspanispan important role sure employees wellrounded lives work suffers 41 vs 23spanp pspansocially conscious businesses attract stronga relnoopener hrefhttpswwwinvestopediacomtermsiimpactinvestingasp target_blankimpact investorsastrong altruistic staff socially conscious customers stuck having fulfil wants myriad stakeholders losing sight initial vision business focusing major global challenge like trying create nuclear cold fusion finding cure diabetes laserfocused aimspanp pspanso support young entrepreneurs help tackle big global issues report suggest main policy interventionsspanp pspanthe embracing triedandtested ways help people ages start scale businesses need access good networks find people mentor collaborate know ins outs running business second bring enterprise allowance scheme coauthor sam dumitriu spanstronga relnoopener hrefhttpscapxcoarevampednewenterpriseallowancewoulddowondersforbusinesscreation target_blankhas written beforeastrongspanspanp pspanthe recommendation think relevant question enabling young entrepreneurs solve big problems issues world faces solutions difficult profit found safe way remove excess carbon dioxide air reverse damage climate change world happier healthier popular clear paying customers makes difficult attract initial investment need research build factoryspanp pspangovernments solve problems build roads provide healthcare people cant afford safe form carbon capture invented governments choose pay use far certain governments simply steal technology hope government pays instead deters investmentspanp pspanone way problem governments credibly commit buying technologies created award challenge prizes invention uk government covid19 vaccine nasa similar find ways supplying international space stationspanp pspanthe advantage challenge prizes solutionblind unlike innovate uk grants government wouldnt need evaluate proposals bluesky research decide like plausible solution instead empower entrepreneurs come ideas find backers private market believe proposal winwin taxpayers government needs payout novel solution foundspanp pspantodays young people healthiest best educated apparently altruistic generation record world bright young minds thinking clever solutions problems role policymakers tools need deliverspanp pemstronga relnoopener hrefhttpscapxcosubscribe datasaferedirecturlhttpswwwgooglecomurlqhttpscapxcosubscribeampsourcegmailampust1666361388668000ampusgaovvaw0hmlzjrryb0jjjz6cootpr target_blankclick subscribe daily briefingastrong best pieces capx webemp pemcapx depends generosity readers value consider making donationemp pthe post relnofollow hrefhttpscapxcoentrepreneursaremorealtruisticthaneverbuthowcanwehelpthemmakegoodontheirambitionsentrepreneurs altruistic help good ambitionsa appeared relnofollow hrefhttpscapxcocapxap

6351ce1504ab371b37888771

Biden backs federal fund for abortion support

ppresident biden said he would support a federal fund to help women pay for abortion procedures while calling on companies to also help their employees pay for reproductive carep pthe answer is absolutely biden told nowthis news when asked in a recent interview if he supports a federal fund for individuals who need to take time off work or obtain child care for an abortionp pi do support that and ive publicly urged companies to do that ive urged them publicly as president of the united states saying this is what you should be doing i urge you to do it because theres so many and imagine the women who need that kind of assistance but have no money at all to be able to do this none what do they do they dont have the option the president saidp pbiden was interviewed alongside danielle mathisen a medical resident pursuing a career in obstetrics and gynecology for nowthis it was recorded on tuesday and will air on sunday at 7 pm etp pthe presidents comments mark a reaffirming of his stance against the hyde amendment which prohibits federal funds from being used to pay for abortionsp pthe hyde amendment first passed congress in 1976 and allows exceptions given for cases of rape incest and when the life of the pregnant person is endangeredp pbiden supported the hyde amendment throughout his long political career but during the democratic presidential primary he said he could no longer support it he was then hailed by reproductive rights groups when he didnt include it in his 2022 budgetp pthe president signed an executive order in august in response to the supreme courts june ruling striking down roe v wade to direct the department of health and human services to consider working with states to use medicaid waivers to pay for expenses for people who cross state lines to receive abortions  p pjust days after the supreme courts ruling several of the nations largest companies said they would be willing to reimburse employees who travel out of state to legally access abortion services those companies included disney meta zillow buzzfeed and amazon among othersp

ppresident biden said support federal fund help women pay abortion procedures calling companies help employees pay reproductive carep pthe answer absolutely biden told nowthis news asked recent interview supports federal fund individuals need time work obtain child care abortionp pi support ive publicly urged companies ive urged publicly president united states saying urge theres imagine women need kind assistance money able dont option president saidp pbiden interviewed alongside danielle mathisen medical resident pursuing career obstetrics gynecology nowthis recorded tuesday air sunday 7 pm etp pthe presidents comments mark reaffirming stance hyde amendment prohibits federal funds pay abortionsp pthe hyde amendment passed congress 1976 allows exceptions given cases rape incest life pregnant person endangeredp pbiden supported hyde amendment long political career democratic presidential primary said longer support hailed reproductive rights groups didnt include 2022 budgetp pthe president signed executive order august response supreme courts june ruling striking roe v wade direct department health human services consider working states use medicaid waivers pay expenses people cross state lines receive abortionsp pjust days supreme courts ruling nations largest companies said willing reimburse employees travel state legally access abortion services companies included disney meta zillow buzzfeed amazon othersp

6351ce2d04ab371b37888774

Biden backs federal fund for abortion support

ppresident biden said he would support a federal fund to help women pay for abortion procedures while calling on companies to also help their employees pay for reproductive carep pthe answer is absolutely biden told nowthis news when asked in a recent interview if he supports a federal fund for individuals who need to take time off work or obtain child care for an abortionp pi do support that and ive publicly urged companies to do that ive urged them publicly as president of the united states saying this is what you should be doing i urge you to do it because theres so many and imagine the women who need that kind of assistance but have no money at all to be able to do this none what do they do they dont have the option the president saidp pbiden was interviewed alongside danielle mathisen a medical resident pursuing a career in obstetrics and gynecology for nowthis it was recorded on tuesday and will air on sunday at 7 pm etp pthe presidents comments mark a reaffirming of his stance against the hyde amendment which prohibits federal funds from being used to pay for abortionsp pthe hyde amendment first passed congress in 1976 and allows exceptions given for cases of rape incest and when the life of the pregnant person is endangeredp pbiden supported the hyde amendment throughout his long political career but during the democratic presidential primary he said he could no longer support it he was then hailed by reproductive rights groups when he didnt include it in his 2022 budgetp pthe president signed an executive order in august in response to the supreme courts june ruling striking down roe v wade to direct the department of health and human services to consider working with states to use medicaid waivers to pay for expenses for people who cross state lines to receive abortions  p pjust days after the supreme courts ruling several of the nations largest companies said they would be willing to reimburse employees who travel out of state to legally access abortion services those companies included disney meta zillow buzzfeed and amazon among othersp

ppresident biden said support federal fund help women pay abortion procedures calling companies help employees pay reproductive carep pthe answer absolutely biden told nowthis news asked recent interview supports federal fund individuals need time work obtain child care abortionp pi support ive publicly urged companies ive urged publicly president united states saying urge theres imagine women need kind assistance money able dont option president saidp pbiden interviewed alongside danielle mathisen medical resident pursuing career obstetrics gynecology nowthis recorded tuesday air sunday 7 pm etp pthe presidents comments mark reaffirming stance hyde amendment prohibits federal funds pay abortionsp pthe hyde amendment passed congress 1976 allows exceptions given cases rape incest life pregnant person endangeredp pbiden supported hyde amendment long political career democratic presidential primary said longer support hailed reproductive rights groups didnt include 2022 budgetp pthe president signed executive order august response supreme courts june ruling striking roe v wade direct department health human services consider working states use medicaid waivers pay expenses people cross state lines receive abortionsp pjust days supreme courts ruling nations largest companies said willing reimburse employees travel state legally access abortion services companies included disney meta zillow buzzfeed amazon othersp

6351cf3504ab371b378887a2

Anti-Male Bias at the NHMRC

img altantimale bias at the nhmrc srchttpss3amazonawscomprodstaticcontentquillettecom202210gettyimages1395187052jpgpppalmost a year ago i wrote about a a hrefhttpswwwnaturecomarticlesd4158602103536wridiculous emnatureem articlea titled outcry as men win outsize share of australian medicalresearch funding its author holly else appeared to welcome a a hrefhttpswwwchangeorgpfundwomeninstemequitablypetitiona calling for the imposition of gender quotas on the awarding of investigator grants by the national health and medical research council nhmrc the petition was created by two female biology researchers and concluded with thispblockquotewe are calling on the nhmrc to improve equity for women in stemm by allocating the same amount of funding to each gender including a separate pot for nonbinary applicants and to set quotas at each of the investigator grant fellowship levels for each gender to ensure that all academic levels are supported with equity please sign with your support for equitable funding for women in stemmblockquotepthose who read past emnatureems inflammatory heading however encountered facts that belied the apparent need for gender quotas at the most junior level else reported women as a whole secured equal amounts of funding to men it was only in the most senior area where a disparity in the opposite direction appeared in that quintile women received just over 20 percent of funding while men received almost 80 percentppthis would represent a serious and potentially inappropriate skewing of funding but for the fact that at the senior level there were four times more male than female applicantscorresponding almost exactly to the funding split so the probability of receiving funding was emessentially identicalem for male and female applicants with no evidence of gender disparities in grant success rates ppwhy then are there more men applying for funding at the senior level the most obvious answer is also the most simplethere are more men than women in the senior ranks of australias health and medical researchers this reflects the fact that scientific fields were until a few decades ago almost entirely dominated by men that era is now over and australian medical schools have achieved gender parity which is reflected in the funding of male and female researchers in mid and junior ranks todayppso it appears that funding reflects gender demographics in a reasonably predictable way and demonstrates a clear move toward gender equality moreover to address any further misconceptions about gender imbalances the nhmrc ceo anne kelso added last year that a hrefhttpswwwnaturecomarticlesd4158601903038wfunding ratesa for men and women were nearly equal in regards to the nhmrcs entire 11 billion budget those concerned about sexism at nhmrc should bear in mind that of its ceo general manager and three executive directors a hrefhttpswwwnhmrcgovauaboutusleadershipandgovernanceseniorexecutiveandleadershipteamonly one is a manappin spite of this evidence the activists behind the fund women in stem equitability petition demanded a systemic gender bias in favor of females and without any obvious rationale in favor of nonbinary applicants as well by the nhmrc that bias has now been officially instituted last week the nhmrc a hrefhttpswwwnaturecomarticlesd41586022032854announced plansa to award half of its research grants for researchers at the midcareer and senior level to women and nonbinary applicantspfigurea hrefhttpswwwnaturecomarticlesd41586022032854divdivgamechanging gender quotas introduced by australian research agencydivdivfrom next year the national health and medical research council will give half of its investigator grants for midcareer and senior scientists to women and nonbinary applicantsdivdivimg altantimale bias at the nhmrc srchttpswwwnaturecomstaticimagesfaviconsnatureappletouchiconf39cb19454pngspannaturespanspanbianca nogradyspandivdivdivimg altantimale bias at the nhmrc srchttpsmedianaturecomlw1024magazineassetsd41586022032854d41586022032854_23599348jpgdivafigurepannamaria arabia chief executive of the australian academy of science in canberra has already called the new policy a gamechanger which she believes will address the significant underrepresentation of women at senior levels a more rational approach might have been to address that underrepresentation directly by simply allowing the natural promotion process for the current equitable crop of female junior researchers to run its course any remaining inequities in funding demographics could then be investigated for bias before resorting to gender quotasppthe nhmrc is no stranger to gender preferences for female applicants however in 2017 a hrefhttpswwwnhmrcgovauresearchpolicygenderequitystructuralpriorityfundingandgenderequityit introduceda structural priority funding which reserves additional moneyaround eight percent of the overall grant budgetfor highquality nearmiss research applications led by women amazingly they are continuing this policy even for juniorlevel researchers where the gender imbalance has already been reversed from 201921 more applications for investigator grants at the earliest career stage came from women who were awarded 137 grants compared to 123 for men remarkably with regard to this latter statistic ceo kelso stated we found that we hardly needed to use any structural priority funding for the more junior levelsppgender politics seem to have trumped basic standards of fairness when it comes to support of stem research at least in australia the inclusion of nonbinary applicants in the new regulations offers a clear indication of this shift nowhere in the claimed disparities has there been any evidence of bias for or against this group the inane preoccupation with bean counting based on gender or identity may seem appealing on the surface as an attempt to ensure equity but equity really ought to imply equal treatment of all individuals irrespective of their gender or other aspects of their selfidentitypfigureblockquote classtwittertweetp langen dirltrthe national consultation on options to reach gender equity in the investigator grant scheme informed the development of gender equity initiatives to commence in 2023 thank you to everyone who contributed during the consultation period a hrefhttpstcojjp4cairz8httpstcojjp4cairz8a a hrefhttpstcoazfngqwjozhttpstcoazfngqwjozap professor anne kelso ceo_nhmrc a hrefhttpstwittercomceo_nhmrcstatus1580009584919400448ref_srctwsrc5etfwoctober 12 2022ablockquote figurepequal opportunity not equal outcome should be the goal of a free society what the nhmrc is now doing by capitulating to an activist group of petitioners is quite the opposite assuming that next years applicant pool is not significantly different than this years senior female researchers will be favored in the selection process compared to males by a factor of four to one in order to achieve equal grant reception ppas i a hrefhttpsquillettecom20211217fundscienceonthebasisofscientistsworknottheiridentityargued a year agoa quotas have a chequered history and were often used to discriminate against minorities rather than assist them pblockquotetoday we properly regard such policies as shameful both for discriminating against individual human beings and for misdirecting societys scientific resources medical science is a lifeanddeath endeavor and decisions about how that science should be funded must be based on the quality of research proposals not the skin color or sex of those submitting themblockquoteplast year i was protesting a flawed proposal this year that flawed proposal has become policyppemnote this article is also appears on the a hrefhttpslawrencekrausssubstackcomptheaustraliannationalhealthandcritical mass susbtackaemp

img altantimale bias nhmrc srchttpss3amazonawscomprodstaticcontentquillettecom202210gettyimages1395187052jpgpppalmost year ago wrote hrefhttpswwwnaturecomarticlesd4158602103536wridiculous emnatureem articlea titled outcry men win outsize share australian medicalresearch funding author holly appeared welcome hrefhttpswwwchangeorgpfundwomeninstemequitablypetitiona calling imposition gender quotas awarding investigator grants national health medical research council nhmrc petition created female biology researchers concluded thispblockquotewe calling nhmrc improve equity women stemm allocating funding gender including separate pot nonbinary applicants set quotas investigator grant fellowship levels gender ensure academic levels supported equity sign support equitable funding women stemmblockquotepthose read past emnatureems inflammatory heading encountered facts belied apparent need gender quotas junior level reported women secured equal amounts funding men senior area disparity opposite direction appeared quintile women received 20 percent funding men received 80 percentppthis represent potentially inappropriate skewing funding fact senior level times male female applicantscorresponding exactly funding split probability receiving funding emessentially identicalem male female applicants evidence gender disparities grant success rates ppwhy men applying funding senior level obvious answer simplethere men women senior ranks australias health medical researchers reflects fact scientific fields decades ago entirely dominated men era australian medical schools achieved gender parity reflected funding male female researchers mid junior ranks todayppso appears funding reflects gender demographics reasonably predictable way demonstrates clear gender equality address misconceptions gender imbalances nhmrc ceo anne kelso added year hrefhttpswwwnaturecomarticlesd4158601903038wfunding ratesa men women nearly equal regards nhmrcs entire 11 billion budget concerned sexism nhmrc bear mind ceo general manager executive directors hrefhttpswwwnhmrcgovauaboutusleadershipandgovernanceseniorexecutiveandleadershipteamonly manappin spite evidence activists fund women stem equitability petition demanded systemic gender bias favor females obvious rationale favor nonbinary applicants nhmrc bias officially instituted week nhmrc hrefhttpswwwnaturecomarticlesd41586022032854announced plansa award half research grants researchers midcareer senior level women nonbinary applicantspfigurea hrefhttpswwwnaturecomarticlesd41586022032854divdivgamechanging gender quotas introduced australian research agencydivdivfrom year national health medical research council half investigator grants midcareer senior scientists women nonbinary applicantsdivdivimg altantimale bias nhmrc srchttpswwwnaturecomstaticimagesfaviconsnatureappletouchiconf39cb19454pngspannaturespanspanbianca nogradyspandivdivdivimg altantimale bias nhmrc srchttpsmedianaturecomlw1024magazineassetsd41586022032854d41586022032854_23599348jpgdivafigurepannamaria arabia chief executive australian academy science canberra called new policy gamechanger believes address significant underrepresentation women senior levels rational approach address underrepresentation directly simply allowing natural promotion process current equitable crop female junior researchers run course remaining inequities funding demographics investigated bias resorting gender quotasppthe nhmrc stranger gender preferences female applicants 2017 hrefhttpswwwnhmrcgovauresearchpolicygenderequitystructuralpriorityfundingandgenderequityit introduceda structural priority funding reserves additional moneyaround percent overall grant budgetfor highquality nearmiss research applications led women amazingly continuing policy juniorlevel researchers gender imbalance reversed 201921 applications investigator grants earliest career stage came women awarded 137 grants compared 123 men remarkably regard statistic ceo kelso stated found hardly needed use structural priority funding junior levelsppgender politics trumped basic standards fairness comes support stem research australia inclusion nonbinary applicants new regulations offers clear indication shift claimed disparities evidence bias group inane preoccupation bean counting based gender identity appealing surface attempt ensure equity equity ought imply equal treatment individuals irrespective gender aspects selfidentitypfigureblockquote classtwittertweetp langen dirltrthe national consultation options reach gender equity investigator grant scheme informed development gender equity initiatives commence 2023 thank contributed consultation period hrefhttpstcojjp4cairz8httpstcojjp4cairz8a hrefhttpstcoazfngqwjozhttpstcoazfngqwjozap professor anne kelso ceo_nhmrc hrefhttpstwittercomceo_nhmrcstatus1580009584919400448ref_srctwsrc5etfwoctober 12 2022ablockquote figurepequal opportunity equal outcome goal free society nhmrc capitulating activist group petitioners opposite assuming years applicant pool significantly different years senior female researchers favored selection process compared males factor order achieve equal grant reception ppas hrefhttpsquillettecom20211217fundscienceonthebasisofscientistsworknottheiridentityargued year agoa quotas chequered history discriminate minorities assist pblockquotetoday properly regard policies shameful discriminating individual human beings misdirecting societys scientific resources medical science lifeanddeath endeavor decisions science funded based quality research proposals skin color sex submitting themblockquoteplast year protesting flawed proposal year flawed proposal policyppemnote article appears hrefhttpslawrencekrausssubstackcomptheaustraliannationalhealthandcritical mass susbtackaemp

6351cf5504ab371b378887a4

My Conversation with Reza Aslan

pon a bunch of normal issues i disagree with him rather vehemently but overall i thought this conversation worked out quite well  here is a relnoopener hrefhttpsconversationswithtylercomepisodesrezaaslan target_blankthe audio and video and transcripta  here is part of the episode summaryp blockquotephe joined tyler to discuss shia and christian notions of martyrdom the heroism of howard baskerville the differences between sunni and shia islam esoteric vs exoteric expressions of religion how mystical movements arise more organically than religion the conflicts over imams in the islamic world how his upbringing as an iranian immigrant shaped his view of religion his roundabout spiritual journey the synthesis of spinoza and sufism the origins of wahhabism the relationship or lackthereof between religion and political philosophy the sad repetition of history in iran his favorite iranian movie and morepblockquote phere is one excerptp blockquote pstrongcowen strongin your understanding can sufism stand alongside the prophetic structure of islam as something separate or is it synthesized with it into one consistent picturep pstrongaslan strongthats a hardcore brilliant theological question because its been debated for generations what i will say is this that sufism is like all mystical traditions incredibly eclectic it comes in thousands of different formsp pthere are some sufis that are very traditionalist very hard to even sometimes tell the difference between them and your basic sunni and there are some sufis that take part in the spectacular displays sometimes a relnoopener hrefhttpswwwyoutubecomwatchvlb17oyo0alw target_blank datahrefhttpswwwyoutubecomwatchvlb17oyo0alwdisplays that involve putting swords through their bodiesa taking part in painful acts ways of trying to deny the self and the body in a way that most muslims would look at and say that looks emnothingem like islam sufism is what a sufi says it is basicallyp pstrongcowen strongif i go to albania and i chat with the a relnoopener hrefhttpsalbanianstudiesweeblycombektashihtml target_blank datahrefhttpsalbanianstudiesweeblycombektashihtmlbektashia how is their version of sufism differentp pstrongaslan strongthen say the naqshbandi absolutely whats great about sufism  and again this is a standard description of all mystical movements  is that they absorb themselves into local cultures and local practices when you have these kinds of deeply spiritual mystical movements they most often arise from the culture theyre not so often brought in from the outsidep preligion in its most orthodox sense is usually introduced to a culture or to a people somebody shows up and says this is islam this is christianity this is buddhism sufism like much of mystical movements is something that comes out of the ground itself and then starts to marry itself to that dominant religionp pwe see a relnoopener hrefhttpswccmorgchristianmysticismonlinecoursewithstefanreynoldsgclideaiaiqobchmiwdxa8jdlgivlbjich2cnw2weaayayaaegktw_d_bwe target_blank datahrefhttpswccmorgchristianmysticismonlinecoursewithstefanreynoldsgclideaiaiqobchmiwdxa8jdlgivlbjich2cnw2weaayayaaegktw_d_bwechristian mysticisma all around the world that in some places looks like paganism and in some places looks like traditional nature worship it uses some of the symbols and metaphors of christianity and it becomes an indigenous version of christianity thats exactly the same thing with sufism and islam it depends on where you go p blockquote pinteresting throughoutp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210myconversationwithrezaaslanhtmlmy conversation with reza aslana appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

pon bunch normal issues disagree vehemently overall thought conversation worked relnoopener hrefhttpsconversationswithtylercomepisodesrezaaslan target_blankthe audio video transcripta episode summaryp blockquotephe joined tyler discuss shia christian notions martyrdom heroism howard baskerville differences sunni shia islam esoteric vs exoteric expressions religion mystical movements arise organically religion conflicts imams islamic world upbringing iranian immigrant shaped view religion roundabout spiritual journey synthesis spinoza sufism origins wahhabism relationship lackthereof religion political philosophy sad repetition history iran favorite iranian movie morepblockquote phere excerptp blockquote pstrongcowenstrongin understanding sufism stand alongside prophetic structure islam separate synthesized consistent picturep pstrongaslanstrongthats hardcore brilliant theological question debated generations sufism like mystical traditions incredibly eclectic comes thousands different formsp pthere sufis traditionalist hard tell difference basic sunni sufis spectacular displays sometimesa relnoopener hrefhttpswwwyoutubecomwatchvlb17oyo0alw target_blank datahrefhttpswwwyoutubecomwatchvlb17oyo0alwdisplays involve putting swords bodiesa taking painful acts ways trying deny self body way muslims look looksemnothingemlike islam sufism sufi says basicallyp pstrongcowenstrongif albania chat thea relnoopener hrefhttpsalbanianstudiesweeblycombektashihtml target_blank datahrefhttpsalbanianstudiesweeblycombektashihtmlbektashia version sufism differentp pstrongaslanstrongthen naqshbandi absolutely whats great sufismand standard description mystical movementsis absorb local cultures local practices kinds deeply spiritual mystical movements arise culture theyre brought outsidep preligion orthodox sense usually introduced culture people somebody shows says islam christianity buddhism sufism like mystical movements comes ground starts marry dominant religionp pwe seea relnoopener hrefhttpswccmorgchristianmysticismonlinecoursewithstefanreynoldsgclideaiaiqobchmiwdxa8jdlgivlbjich2cnw2weaayayaaegktw_d_bwe target_blank datahrefhttpswccmorgchristianmysticismonlinecoursewithstefanreynoldsgclideaiaiqobchmiwdxa8jdlgivlbjich2cnw2weaayayaaegktw_d_bwechristian mysticismaall world places looks like paganism places looks like traditional nature worship uses symbols metaphors christianity indigenous version christianity thats exactly thing sufism islam depends gop blockquote pinteresting throughoutp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210myconversationwithrezaaslanhtmlmy conversation reza aslana appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

6351cfa004ab371b378887ad

Why Truss’s gamble failed

pshortly before the governments illfated budget i had coffee with a conservative mp who was keen to stress that the tory party was heading towards disaster it isnt going to work the mp told me likening trusss breakneck dash for growth to a relnoopener hrefhttpswwwtheguardiancomuknews2022sep25whythebarberboomthatkwasikwartengsminibudgetrecallswasdestinedfordisaster target_blankthe barber budget of 1971a which created sudden unsustainable gdp growth followed by a calamitous economic crash a naive irresponsible gamble a relnoopener hrefhttpswwwamazoncoukstateemergencywerebritain19701974dp0141032154 target_blankas dominic sandbrook has ita based on rosily optimistic predictions that were never ever vindicated the mp was right up to a point we got the bust without the intervening boomp pinstead trusss dash for growth spooked the markets which disbelieved her tax cuts could ever create enough growth to pay for her massive borrowing and in a desperate attempt to mollify them weve been suddenly plunged back to the grim economics of austerity learning nothing from the last time public spending will be slashed along with investment in a relnoopener hrefhttpswwwnewelectronicscoukcontentblogsisbritishsciencefacingadoublewhammy target_blankresearch and developmenta hobbling prospects of future growth at this stage and in such a deteriorating international climate a return to stagnation would seem almost like a blessed relief but theres another way of looking at the problem as the mp wondered out loud do normal people even care about growth anywayp pits a good question as the authors of a relnoopener hrefhttpswwwversobookscombooks3989thefutureisdegrowth target_blankemthe future is degrowthema remind us despite being taken for granted by economists and ordinary people alike gdp growth as a measure of economic health is a very recent phenomenon the product of the need to measure the success of investment and to track industrial capacity during the second world war as they observe before 1950 there was almost no interest at all in economic growth as a policy goal in political statements or economic literature rather full employment stability and reconstruction were the governments prioritiesp divdiv pthe oneoff conjunction of spectacular growth rates and rising living standards following the second world war led they argue to a folk association of gdp growth and personal prosperity as they argue the fact that key democratic social and cultural rights were fought for in the context of expansive modernity and that within the growth paradigm societal progress became conflated with gdp growth has laid the foundation for a powerful common sense based on lived experience that social improvements do indeed require economic growth and the development of the productive forcesp pits not an unreasonable deduction of course postwar high growth rates did translate to a certain democratisation of prosperity yet the relationship between gdp growth and prosperity is far from exact britains economy grew 75 last year as we came out of lockdown a relnoopener hrefhttpswwwstatistacomstatistics281734gdpgrowthintheunitedkingdomuk target_blankdwarfing the postwar booma though few would claim weve never had it so good as in the halcyon days of 2021 the highest ever upward gdp swing came in 1939 as britain pivoted to a war economy though the second world war was hardly a golden era of mass prosperity at the peak of britains industrial economic and political might in the 19th century a hrefhttpsacademicoupcombook27085growth rates averaged 11a significantly below gdp growth during the 2010s commonly experienced as an era of stagnation and falling living standards the a relnoopener hrefhttpswarontherockscom202210theendoftheworldisnigh target_blankunsettling prospect of an imminent nuclear exchangea would after what would admittedly be a sharp fall in gdp surely unlock a great deal of potential for longterm economic growth as the survivors rebuilt europes irradiated ruins most people would nevertheless prefer it not to happen there are simply many more aspects to prosperity than abstract gdp growth the map is not the territoryp diva hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnara hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages1243671929scalede1664794089552300x154jpgadiva hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarh5liz truss has betrayed conservatismh5apa hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarspanbyspan aris roussinosapdivadiv pso much for the abstract in the real world living standards are dropping sharply as public spending cuts have led to a collapsing health service creaking transport infrastructure and the polices withdrawal from their basic functions of providing law and order the stratospheric upward rise in housing costs functions on paper as gdp growth even as it erodes actual prosperity desperate attempts to make the line go up on the chart whether through thatchers selloff of public assets the shifting of industrial production to the far east or the conversion of western economies to debtfueled speculative bubbles have all brought temporary bursts of gdp growth even as they made the economys fundamentals weaker and brought lower living standards in their wake we need a different way the problem is noone agrees what that way isp pit is reasonable to assume as has now swiftly become common opinion that just as the economic crash of the seventies swung the pendulum of economic orthodoxy away from keynesianism towards freemarket capitalism so is the pendulum now swinging violently back away from what it is politically useful to term libertarianism but to whatp pthe labour party after some prevarication seems to have settled on a modest version of the green new deal an attempt to revive economic growth through massive investment in sustainable technologies in doing so it has emulated a relnoopener hrefhttpswwwtheguardiancomcommentisfree2022aug14theguardianviewonbidensgreendealleadershipaftertrumpsdenialism target_blankbidensa green neokeynesianism emphasising that once again a relnoopener hrefhttpswwwbbccouknewsworld63276374 target_blankwhere american politics leads economic orthodoxy eventually followsa whether or not such a course of action will save the planet and the reality is that there is no obvious replacement for fossil fuels without massive expansion of nuclear energy the green new deal can be understood as an attempt to restart the stuttering engine of gdp growth through a second industrial revolution this time undoing the unintended consequences of the firstp pwill it work whether or not the markets will look as favourably on a starmer governments push for green industrial investment as it does those of america remains to be seen there is a great danger that trusss botched push for growth has queered the pitch for any future radical attempt to escape stagnation but then if we disentangle the quest for prosperity from that for gdp growth the answer is that it almost doesnt matterp diva hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnara hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages12437237791300x169jpgadiva hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarspansuggested readingspanaa hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarh5kwasi kwarteng was the wrong sort of cleverh5apa hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarspanbyspan dominic sandbrookapdivadiv pif the country has a reliable energy supply has the industrial capacity to sustain the levels of technological sophistication to which we are accustomed and can provide secure food and housing to its population the hard years we are entering may still be experienced as an era of basic comfort as a number of economists have declared the age of growth may in any case have already gone for good with all the advanced economies a relnoopener hrefhttpswwwintereconomicseucontentsyear2019number5articlejapaneseeconomytwolostdecadesandhowmanymorehtml target_blankfollowing japana into a relnoopener hrefhttplarrysummerscom20160217theageofsecularstagnation target_blanka long cycle of secular stagnationa at best a broadly comfortable steady state economy with no dramatic peaks or troughs as the a relnoopener hrefhttpswwwcuspacukwpcontentuploadswp12thepostgrowthchallenge12mbpdf target_blankpostgrowth economist tim jackson observesa low and declining rates of economic growth may well be the new normalp psuch a vision accords with the vision of the sociologist michael mann who in the 2013 book a hrefhttpsglobaloupcomacademicproductdoescapitalismhaveafuture9780199330850ccgblangenemdoes capitalism have a futureema breaks sharply with the predictions of his coauthors that global capitalism will collapse some time between 2030 and 2050 instead he argues why should a growth rate of 1 be a capitalist crisis why cannot capitalism continue as a lowgrowth global system which it was for much of its history the 20th century more precisely the period 1945 to 1970 in the west and the end of the 20th century in the east would then be seen as exceptional even chinas spectacular growth rate might be reduced down to the 1 level of the historic british success story so that all of humanity might live in an almost steadystate economy the future of capitalism he suggests might not be tumultuous but boringp pbut in the current international climate steady and boring would look like an almost unattainable win in general terms despite every desperate attempt for a quick fix the global economy has never recovered the sustained growth rates of the postwar era and probably never will battered by the seventies oil crisis the global financial crash of 2008 the response to covid and now by the war in ukraine the world economy still has a relnoopener hrefhttpswwwcsisorganalysisarewashingtonandbeijingcollisioncourseovertaiwandipippo target_blankthe effectsa of the looming conflict between the us and china to prepare for along with the increasingly tangible consequences of climate changep pit is just as possible indeed probably more likely that we have entered an age of growing compound crisis almost a decade ago the authors of emdoes capitalism have a futureem warned that something big looms on the horizon a structural crisis much bigger than the recent great recession as we await the blackouts and disorder of the coming winter and try not to think about the prospects of nuclear war it would be reasonable to act on the assumption this crisis has already begunp diva hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnara hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages12437163051300x169jpgadiva hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarspansuggested readingspanaa hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarh5the tories are the antigrowth coalitionh5apa hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarspanbyspan james sean dicksonapdivadiv pin these bleak circumstances a focus on shoring up nearterm national resilience ought to take precedence over the prioritising of longterm growth when the confrontation between the united states and china begins and the us government is now briefing that the invasion of taiwan can be expected a relnoopener hrefhttpswwwbloombergcomnewsarticles20221017blinkensayschinawantstaiwanonmuchfastertimeline target_blanksooner than we thoughta none of the current market orthodoxies will still apply whatever economic plans are laid now no matter how palatable they are to the markets will not survivep pin planning his invasion of ukraine putin evidently priced in western sanctions and russias ejection from the international banking sector gambling that its vast mineral resources and energy resources would count for more in the world today than the economic commonsense of yesterday as winter approaches it is not yet clear that putin has lost this bet like the first world war the conflict in ukraine makes no conventional economic sense but has created its own new reality similarly to win a protracted pacific war against the greatest industrial power in human history the united states would have to reorient its entire economy around the war effort the panicked reactions of the market to trusss minibudget no more reflect the approaching colossal reordering of the global economy than westminster lobby gossip and downing street psychodrama reflect the great geopolitical trends already reshaping the world around usp pat times like this its hard not to feel nostalgic for the end of history like youth it will not come again it would have been far better if the decades of bad decisions that brought us here had not been made but they were and now we must suffer the consequences as best we can even the years of austerity following the 2008 crash now seem a lost hinterland of wasted opportunity we could have invested in state capacity to see us through the hard years we have now entered we could have expanded gas storage facilities instead of shutting them down we could have built nuclear power plants highspeed rail and all the infrastructure on which modern life in a developed nation depends at a time when borrowing costs were practically nonexistentp pinstead we feel the absence of investment just when we need state capacity the most and are least able to afford it like the grasshopper in aesops fable we frittered away the summer without providing for the winter to come and now we shudder as the first cold winds begin to whip around us but at least the line on the chart went up a little as the government of the day reassured the marketsp diva hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnara hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages1235522957scalede1663674738789300x181jpgadiva hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarh5can europe survive the age of strongmenh5apa hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarspanbyspan aris roussinosapdivadiv pjust as we now perceive that we should have used better times to prepare for today so it will swiftly become clear that we should be using the time we have now to prepare for the worse ones fast approaching what we perceive as crisis is still a period of relative normality at a time when the international situation is as menacing as it is it would be comforting to have at the barest minimum a functioning government instead we have liz truss sitting on the front bench staring blankly into space as her party and country crumble around herp pis she in charge is anyone it ought to be impossible for truss to blame the deteriorating international situation for her political woes without also proposing some measures to mitigate britains exposure to the global crisis but instead she broke her premiership and the countrys government chasing gdp growth it may never have been in her power to attainp pwhen starmer wins the next election he will be required to spend vast sums of money in rebuilding britains decayed infrastructure fixing the roof while the rains lash down given the international situation labour is correct in framing its proposed investment in infrastructure as much as a question of national security as a path to economic growth debt will grow and it will have to survival comes first and abstract economic growth must be subordinated to this very basic goal when even europes economic giant germany is trying to stave off industrial collapse the idea that growth can be attained in the current circumstances seems entirely divorced from realityp pas eminent american economists now emphasise a relnoopener hrefhttpswwwnytimescom20220908opinioneuroperussiaenergyhtml target_blanknearwartime situationsa such as ours a relnoopener hrefhttpswwwnytimescom20220908opinioneuroperussiaenergyhtml target_blankare not won with peacetime economiesa the old rules do not apply in any case the feeble growth we experienced in recent years a relnoopener hrefhttpswwwresolutionfoundationorgpublicationswhoownsallthepie target_blankaccumulated at the top without bringing mass prosperitya voters are unlikely to punish a government that offers them higher living standards through redistribution even a relnoopener hrefhttpswwwnewyorkercommagazine20200210canwehaveprosperitywithoutgrowth target_blankwithout gdp growtha in the absence of growth labour must provide the basics of common comfort if people can still eat heat their homes and shelter themselves from the weather they will count themselves prosperous even if the gdp charts say otherwisep a hrefhttpsunherdcom202210growthwontsavebritainappcommentsview 18 commentsa

pshortly governments illfated budget coffee conservative mp keen stress tory party heading disaster isnt going work mp told likening trusss breakneck dash growth relnoopener hrefhttpswwwtheguardiancomuknews2022sep25whythebarberboomthatkwasikwartengsminibudgetrecallswasdestinedfordisaster target_blankthe barber budget 1971a created sudden unsustainable gdp growth followed calamitous economic crash naive irresponsible gamble relnoopener hrefhttpswwwamazoncoukstateemergencywerebritain19701974dp0141032154 target_blankas dominic sandbrook ita based rosily optimistic predictions vindicated mp right point got bust intervening boomp pinstead trusss dash growth spooked markets disbelieved tax cuts create growth pay massive borrowing desperate attempt mollify weve suddenly plunged grim economics austerity learning time public spending slashed investment relnoopener hrefhttpswwwnewelectronicscoukcontentblogsisbritishsciencefacingadoublewhammy target_blankresearch developmenta hobbling prospects future growth stage deteriorating international climate return stagnation like blessed relief theres way looking problem mp wondered loud normal people care growth anywayp pits good question authors relnoopener hrefhttpswwwversobookscombooks3989thefutureisdegrowth target_blankemthe future degrowthema remind despite taken granted economists ordinary people alike gdp growth measure economic health recent phenomenon product need measure success investment track industrial capacity second world war observe 1950 interest economic growth policy goal political statements economic literature employment stability reconstruction governments prioritiesp divdiv pthe oneoff conjunction spectacular growth rates rising living standards following second world war led argue folk association gdp growth personal prosperity argue fact key democratic social cultural rights fought context expansive modernity growth paradigm societal progress conflated gdp growth laid foundation powerful common sense based lived experience social improvements require economic growth development productive forcesp pits unreasonable deduction course postwar high growth rates translate certain democratisation prosperity relationship gdp growth prosperity far exact britains economy grew 75 year came lockdown relnoopener hrefhttpswwwstatistacomstatistics281734gdpgrowthintheunitedkingdomuk target_blankdwarfing postwar booma claim weve good halcyon days 2021 highest upward gdp swing came 1939 britain pivoted war economy second world war hardly golden era mass prosperity peak britains industrial economic political 19th century hrefhttpsacademicoupcombook27085growth rates averaged 11a significantly gdp growth 2010s commonly experienced era stagnation falling living standards relnoopener hrefhttpswarontherockscom202210theendoftheworldisnigh target_blankunsettling prospect imminent nuclear exchangea admittedly sharp fall gdp surely unlock great deal potential longterm economic growth survivors rebuilt europes irradiated ruins people prefer happen simply aspects prosperity abstract gdp growth map territoryp diva hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnara hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages1243671929scalede1664794089552300x154jpgadiva hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarspanmore authorspanaa hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarh5liz truss betrayed conservatismh5apa hrefhttpsunherdcom202210liztrusshasbetrayedconservatismrefinnarspanbyspan aris roussinosapdivadiv pso abstract real world living standards dropping sharply public spending cuts led collapsing health service creaking transport infrastructure polices withdrawal basic functions providing law order stratospheric upward rise housing costs functions paper gdp growth erodes actual prosperity desperate attempts line chart thatchers selloff public assets shifting industrial production far east conversion western economies debtfueled speculative bubbles brought temporary bursts gdp growth economys fundamentals weaker brought lower living standards wake need different way problem agrees way isp pit reasonable assume swiftly common opinion economic crash seventies swung pendulum economic orthodoxy away keynesianism freemarket capitalism pendulum swinging violently away politically useful term libertarianism whatp pthe labour party prevarication settled modest version green new deal attempt revive economic growth massive investment sustainable technologies emulated relnoopener hrefhttpswwwtheguardiancomcommentisfree2022aug14theguardianviewonbidensgreendealleadershipaftertrumpsdenialism target_blankbidensa green neokeynesianism emphasising relnoopener hrefhttpswwwbbccouknewsworld63276374 target_blankwhere american politics leads economic orthodoxy eventually followsa course action save planet reality obvious replacement fossil fuels massive expansion nuclear energy green new deal understood attempt restart stuttering engine gdp growth second industrial revolution time undoing unintended consequences firstp pwill work markets look favourably starmer governments push green industrial investment america remains seen great danger trusss botched push growth queered pitch future radical attempt escape stagnation disentangle quest prosperity gdp growth answer doesnt matterp diva hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnara hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages12437237791300x169jpgadiva hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarspansuggested readingspanaa hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarh5kwasi kwarteng wrong sort cleverh5apa hrefhttpsunherdcom202210kwasikwartengwasthewrongsortofcleverrefinnarspanbyspan dominic sandbrookapdivadiv pif country reliable energy supply industrial capacity sustain levels technological sophistication accustomed provide secure food housing population hard years entering experienced era basic comfort number economists declared age growth case gone good advanced economies relnoopener hrefhttpswwwintereconomicseucontentsyear2019number5articlejapaneseeconomytwolostdecadesandhowmanymorehtml target_blankfollowing japana relnoopener hrefhttplarrysummerscom20160217theageofsecularstagnation target_blanka long cycle secular stagnationa best broadly comfortable steady state economy dramatic peaks troughs relnoopener hrefhttpswwwcuspacukwpcontentuploadswp12thepostgrowthchallenge12mbpdf target_blankpostgrowth economist tim jackson observesa low declining rates economic growth new normalp psuch vision accords vision sociologist michael mann 2013 book hrefhttpsglobaloupcomacademicproductdoescapitalismhaveafuture9780199330850ccgblangenemdoes capitalism futureema breaks sharply predictions coauthors global capitalism collapse time 2030 2050 instead argues growth rate 1 capitalist crisis capitalism continue lowgrowth global system history 20th century precisely period 1945 1970 west end 20th century east seen exceptional chinas spectacular growth rate reduced 1 level historic british success story humanity live steadystate economy future capitalism suggests tumultuous boringp pbut current international climate steady boring look like unattainable win general terms despite desperate attempt quick fix global economy recovered sustained growth rates postwar era probably battered seventies oil crisis global financial crash 2008 response covid war ukraine world economy relnoopener hrefhttpswwwcsisorganalysisarewashingtonandbeijingcollisioncourseovertaiwandipippo target_blankthe effectsa looming conflict china prepare increasingly tangible consequences climate changep pit possible probably likely entered age growing compound crisis decade ago authors emdoes capitalism futureem warned big looms horizon structural crisis bigger recent great recession await blackouts disorder coming winter try think prospects nuclear war reasonable act assumption crisis begunp diva hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnara hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarimg srchttpsunherdcomwpcontentuploads202210gettyimages12437163051300x169jpgadiva hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarspansuggested readingspanaa hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarh5the tories antigrowth coalitionh5apa hrefhttpsunherdcom202210thetoriesaretheantigrowthcoalitionrefinnarspanbyspan james sean dicksonapdivadiv pin bleak circumstances focus shoring nearterm national resilience ought precedence prioritising longterm growth confrontation united states china begins government briefing invasion taiwan expected relnoopener hrefhttpswwwbloombergcomnewsarticles20221017blinkensayschinawantstaiwanonmuchfastertimeline target_blanksooner thoughta current market orthodoxies apply economic plans laid matter palatable markets survivep pin planning invasion ukraine putin evidently priced western sanctions russias ejection international banking sector gambling vast mineral resources energy resources count world today economic commonsense yesterday winter approaches clear putin lost bet like world war conflict ukraine makes conventional economic sense created new reality similarly win protracted pacific war greatest industrial power human history united states reorient entire economy war effort panicked reactions market trusss minibudget reflect approaching colossal reordering global economy westminster lobby gossip downing street psychodrama reflect great geopolitical trends reshaping world usp pat times like hard feel nostalgic end history like youth come far better decades bad decisions brought suffer consequences best years austerity following 2008 crash lost hinterland wasted opportunity invested state capacity hard years entered expanded gas storage facilities instead shutting built nuclear power plants highspeed rail infrastructure modern life developed nation depends time borrowing costs practically nonexistentp pinstead feel absence investment need state capacity able afford like grasshopper aesops fable frittered away summer providing winter come shudder cold winds begin whip line chart went little government day reassured marketsp diva hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnara hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages1235522957scalede1663674738789300x181jpgadiva hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarspanmore authorspanaa hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarh5can europe survive age strongmenh5apa hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenrefinnarspanbyspan aris roussinosapdivadiv pjust perceive better times prepare today swiftly clear time prepare worse ones fast approaching perceive crisis period relative normality time international situation menacing comforting barest minimum functioning government instead liz truss sitting bench staring blankly space party country crumble herp pis charge ought impossible truss blame deteriorating international situation political woes proposing measures mitigate britains exposure global crisis instead broke premiership countrys government chasing gdp growth power attainp pwhen starmer wins election required spend vast sums money rebuilding britains decayed infrastructure fixing roof rains lash given international situation labour correct framing proposed investment infrastructure question national security path economic growth debt grow survival comes abstract economic growth subordinated basic goal europes economic giant germany trying stave industrial collapse idea growth attained current circumstances entirely divorced realityp pas eminent american economists emphasise relnoopener hrefhttpswwwnytimescom20220908opinioneuroperussiaenergyhtml target_blanknearwartime situationsa relnoopener hrefhttpswwwnytimescom20220908opinioneuroperussiaenergyhtml target_blankare won peacetime economiesa old rules apply case feeble growth experienced recent years relnoopener hrefhttpswwwresolutionfoundationorgpublicationswhoownsallthepie target_blankaccumulated bringing mass prosperitya voters unlikely punish government offers higher living standards redistribution relnoopener hrefhttpswwwnewyorkercommagazine20200210canwehaveprosperitywithoutgrowth target_blankwithout gdp growtha absence growth labour provide basics common comfort people eat heat homes shelter weather count prosperous gdp charts otherwisep hrefhttpsunherdcom202210growthwontsavebritainappcommentsview 18 commentsa

63531e13798765837b563afb

Biden to Republicans on student loan plan: ‘Who the hell do they think they are?’

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden on friday bashed republicans who have attacked his student loan forgiveness plan calling out certain lawmakers like sen ted cruz texas and rep marjorie taylor green gap pted cruz the great senator from texas he said its for slackers quote slackers who dont deserve relief who the hell do they think they are biden said in remarks at delaware state universityp pthe president specifically criticized lawmakers who have opposed his student loan forgiveness plan but who received small business loans during the covid19 pandemicp pi dont want to hear it from maga republican officials who had hundreds of thousands of dollars of debts even millions of dollars in pandemic relief loans forgiven who now are attacking me for helping working and middleclass americans he saidp pmarjorie taylor green she and her husband got 180000 in business loans forgiven from the [paycheck protect program] she said its completely unfair to us to forgive loans for working and middleclass americansp phe also mentioned rep vern buchanan rga who called the plan reckless but got 23 million in business loans forgiven through pppp ptheir outrage is raw and its hypocritical but you know were not letting them get away with it biden saidp pthe plan has faced multiple lawsuits but biden took a victory lap friday after supreme court justice amy coney barrett on thursday denied an emergency bid by a group of wisconsin taxpayers asking the court to block the programp pa federal judge separately dismissed a legal challenge from six republicanled states to the plan ruling that they do not have standing to suep pthe plan is set to forgive up to 10000 in federal student loan debt for borrowers earning under 125000 and as much as 20000 for borrowers who received pell grants applications officially opened on monday and as of friday 22 million americans had applied for forgiveness p pemupdated at 508 pmemp

figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden friday bashed republicans attacked student loan forgiveness plan calling certain lawmakers like sen ted cruz texas rep marjorie taylor green gap pted cruz great senator texas said slackers quote slackers dont deserve relief hell think biden said remarks delaware state universityp pthe president specifically criticized lawmakers opposed student loan forgiveness plan received small business loans covid19 pandemicp pi dont want hear maga republican officials hundreds thousands dollars debts millions dollars pandemic relief loans forgiven attacking helping working middleclass americans saidp pmarjorie taylor green husband got 180000 business loans forgiven [paycheck protect program] said completely unfair forgive loans working middleclass americansp phe mentioned rep vern buchanan rga called plan reckless got 23 million business loans forgiven pppp ptheir outrage raw hypocritical know letting away biden saidp pthe plan faced multiple lawsuits biden took victory lap friday supreme court justice amy coney barrett thursday denied emergency bid group wisconsin taxpayers asking court block programp pa federal judge separately dismissed legal challenge republicanled states plan ruling standing suep pthe plan set forgive 10000 federal student loan debt borrowers earning 125000 20000 borrowers received pell grants applications officially opened monday friday 22 millionamericans applied forgivenessp pemupdated 508 pmemp

63531eea798765837b563b18

Biden administration to expand use of medication to treat addiction in pregnant women

ppresident biden will move to expand the use of medication to treat addiction in pregnant women through a new initiative as part of the administrations strategy to improve maternal health p pthe initiative will develop training and technical assistance about medications for opioid addiction treatment like buprenorphine and methadone for women who are part of government programs through the department of justice and the department of health and human services it also will offer opioid addition education to womens health providers through the department of veterans affairsp pmedications to treat opioid use disorder improve birth outcomes making it less likely newborns will be born too early medications to treat opioid use disorder prevent and reduce the risk of maternal overdose and death stated a fact sheet released by the white houses office of national drug control policyp padditionally the initiative will expand access to medications for opioid addiction for pregnant women and women of reproductive age within tribal nations and living in tribal communities particularly in urban areasp pthe initiative is based off a report conducted by the administration to improve maternal health which medical professionals early childhood experts and others contributed to the use of opioids among pregnant women is considered a significant public health concern by the centers for disease control and prevention cdcp pthe number of women with opioidrelated diagnoses documented at delivery increased by 131 percent from 2010 to 2017 and 7 percent of women said they used opioids during pregnancy in 2019  p popioid use during pregnancy can lead to preterm birth stillbirth and maternal mortality among other negative health outcomes according to the cdcp pwhile using medications to treat an opioid addiction during pregnancy could cause newborn drug withdrawal it will decrease the chances an infant will be born too early according to the fact sheet meanwhile newborn drug withdrawal could be resolved within the first few weeks of lifep

ppresident biden expand use medication treat addiction pregnant women new initiative administrations strategy improve maternal healthp pthe initiative develop training technical assistance medications opioid addiction treatment like buprenorphine methadone women government programs department justice department health human services offer opioid addition education womens health providers department veterans affairsp pmedications treat opioid use disorder improve birth outcomes making likely newborns born early medications treat opioid use disorder prevent reduce risk maternal overdose death stated fact sheet released white houses office national drug control policyp padditionally initiative expand access medications opioid addiction pregnant women women reproductive age tribal nations living tribal communities particularly urban areasp pthe initiative based report conducted administration improve maternal health medical professionals early childhood experts contributed use opioids pregnant women considered significant public health concern centers disease control prevention cdcp pthe number women opioidrelated diagnoses documented delivery increased 131 percent 2010 2017 7 percent women said opioids pregnancy 2019 p popioid use pregnancy lead preterm birth stillbirth maternal mortality negative health outcomes according cdcp pwhile medications treat opioid addiction pregnancy cause newborn drug withdrawal decrease chances infant born early according fact sheet newborn drug withdrawal resolved weeks lifep

63531eeb798765837b563b19

Biden administration to expand use of medication to treat addiction in pregnant women

ppresident biden will move to expand the use of medication to treat addiction in pregnant women through a new initiative as part of the administrations strategy to improve maternal health p pthe initiative will develop training and technical assistance about medications for opioid addiction treatment like buprenorphine and methadone for women who are part of government programs through the department of justice and the department of health and human services it also will offer opioid addition education to womens health providers through the department of veterans affairsp pmedications to treat opioid use disorder improve birth outcomes making it less likely newborns will be born too early medications to treat opioid use disorder prevent and reduce the risk of maternal overdose and death stated a fact sheet released by the white houses office of national drug control policyp padditionally the initiative will expand access to medications for opioid addiction for pregnant women and women of reproductive age within tribal nations and living in tribal communities particularly in urban areasp pthe initiative is based off a report conducted by the administration to improve maternal health which medical professionals early childhood experts and others contributed to the use of opioids among pregnant women is considered a significant public health concern by the centers for disease control and prevention cdcp pthe number of women with opioidrelated diagnoses documented at delivery increased by 131 percent from 2010 to 2017 and 7 percent of women said they used opioids during pregnancy in 2019  p popioid use during pregnancy can lead to preterm birth stillbirth and maternal mortality among other negative health outcomes according to the cdcp pwhile using medications to treat an opioid addiction during pregnancy could cause newborn drug withdrawal it will decrease the chances an infant will be born too early according to the fact sheet meanwhile newborn drug withdrawal could be resolved within the first few weeks of lifep

ppresident biden expand use medication treat addiction pregnant women new initiative administrations strategy improve maternal healthp pthe initiative develop training technical assistance medications opioid addiction treatment like buprenorphine methadone women government programs department justice department health human services offer opioid addition education womens health providers department veterans affairsp pmedications treat opioid use disorder improve birth outcomes making likely newborns born early medications treat opioid use disorder prevent reduce risk maternal overdose death stated fact sheet released white houses office national drug control policyp padditionally initiative expand access medications opioid addiction pregnant women women reproductive age tribal nations living tribal communities particularly urban areasp pthe initiative based report conducted administration improve maternal health medical professionals early childhood experts contributed use opioids pregnant women considered significant public health concern centers disease control prevention cdcp pthe number women opioidrelated diagnoses documented delivery increased 131 percent 2010 2017 7 percent women said opioids pregnancy 2019 p popioid use pregnancy lead preterm birth stillbirth maternal mortality negative health outcomes according cdcp pwhile medications treat opioid addiction pregnancy cause newborn drug withdrawal decrease chances infant born early according fact sheet newborn drug withdrawal resolved weeks lifep

63531f62798765837b563b29

Biden roasts Oz: ‘Delaware was smart enough to send him to New Jersey’

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden on thursday roasted pennsylvania senate hopeful mehmet oz during a fundraiser saying that delaware was smart to send the republican to new jerseyp pdelaware was smart enough to send him to new jersey the president said noting that oz went to high school in bidens home state of delawarep poz who is running in pennsylvania for an open seat in the senate against democratic lt gov john fetterman has been targeted by democrats throughout the midterm cycle for not being from the keystone state and recently moving there oz was born in cleveland raised in wilmington del lived in cliffside park nj and moved to pennsylvania in 2020p pbiden said in his remarks at the fundraiser that fetterman has integrityp pyou never have to wonder that he means what he says biden said adding that oz is for undoing everything we have donep pfetterman and biden spent the day together in pennsylvania on thursdayp pearlier that day the two democrats were in pittsburgh where the president gave remarks on the bipartisan infrastructure law biden thanked fetterman for running for the senate and said that his wife gisele fetterman is going to be a great lady in the senatep pnew polling this week showed oz is polling within the margin of error against fetterman a relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3694903ozclosesgapwithfettermaninnewpennsylvaniapoll target_blankeffectively tying the two candidatesa fetterman received 48 percent support among likely voters and oz received 46 percent in an aarp pennsylvania poll released on tuesdayp pfetterman and oz are running for the seat being vacated by sen pat toomey r who narrowly won his reelection bid in 2016p pcook political report rates the seat as a tossupp

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden thursday roasted pennsylvania senate hopeful mehmet oz fundraiser saying delaware smart send republican new jerseyp pdelaware smart send new jersey president said noting oz went high school bidens home state delawarep poz running pennsylvania open seat senate democratic lt gov john fetterman targeted democrats midterm cycle keystone state recently moving oz born cleveland raised wilmington del lived cliffside park nj moved pennsylvania 2020p pbiden said remarks fundraiser fetterman integrityp pyou wonder means says biden said adding oz undoing donep pfetterman biden spent day pennsylvania thursdayp pearlier day democrats pittsburgh president gave remarks bipartisan infrastructure law biden thanked fetterman running senate said wife gisele fetterman going great lady senatep pnew polling week showed oz polling margin error fetterman relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3694903ozclosesgapwithfettermaninnewpennsylvaniapoll target_blankeffectively tying candidatesa fetterman received 48 percent support likely voters oz received 46 percent aarp pennsylvania poll released tuesdayp pfetterman oz running seat vacated sen pat toomey r narrowly won reelection bid 2016p pcook political report rates seat tossupp

63531f84798765837b563b2e

Biden to call out Republicans for attacks on student loan forgiveness plan

ppresident biden on friday will blast republican lawmakers for attacks on his student loan forgiveness plan in remarks at delaware state universityp phe will call out republican members of congress attacking his efforts to give middleclass families some additional breathing room even as these very officials had hundreds of thousands of dollars of their own pandemic relief loans forgiven by the federal government according to a white house officialp pthe plan unveiled in august has been faced with multiple lawsuits as well as criticism from republicans over how much it will cost taxpayers it is set to forgive up to 10000 in federal student loan debt for borrowers earning under 125000 and as much as 20000 for borrowers who received pell grantsp pbiden will give an update on the launch of the plan on friday on the heels of multiple courts rejecting attempts by republican officials to block the biden administrations student debt relief plan the official said p papplications officially opened on monday and as of tuesday 12 million americans had applied for forgiveness p pon thursday justice amy coney barrett denied an emergency bid by a group of wisconsin taxpayers for the supreme court to block the program by ruling that the cancellation plan illegally encroaches on congresss exclusive spending power also a federal judge dismissed a legal challenge from six republicanled states to the plan ruling that they do not have standing to suep pearlier this week the cato institute sued the department of education over the plan also claiming it is illegal because congress didnt authorize itp pon friday biden will also highlight the role of historically black college and universities and his administrations role in strengthening them delaware state university is a hbcu and over 75 percent of its students received a pell grantp pthe president will highlight the lifechanging impact student debt relief will have on millions of working and middleclass americans particularly borrowers of color the official saidp pthe president will be joined by delaware sens tom carper d and chris coons d rep lisa blunt rochester d and gov john carney dp

ppresident biden friday blast republican lawmakers attacks student loan forgiveness plan remarks atdelaware state universityp phe republican members congress attacking hisefforts middleclass families additional breathing room officials hundreds thousands dollars pandemic relief loans forgiven federal government according white house officialp pthe plan unveiled august faced multiple lawsuits criticism republicans cost taxpayers set forgive 10000 federal student loan debt borrowers earning 125000 20000 borrowers received pell grantsp pbiden update launch plan friday heels multiple courts rejecting attempts republican officials block biden administrations student debt relief plan official saidp papplications officially opened monday tuesday 12 million americans applied forgivenessp pon thursday justice amy coney barrett denied emergency bid group wisconsin taxpayers supreme court block program ruling cancellation plan illegally encroaches congresss exclusive spending power federal judge dismissed legal challenge republicanled states plan ruling standing suep pearlier week cato institute sued department education overthe plan claiming illegal congress didnt authorize itp pon friday biden highlight role historically black college universities administrations role strengthening delaware state university hbcu 75 percent students received pell grantp pthe president highlight lifechanging impact student debt relief millions working middleclass americans particularly borrowers color official saidp pthe president joined delaware sens tom carper d chris coons d rep lisa blunt rochesterd gov john carney dp

63560e3e3aa0fa99976324d1

Chomsky and Pollin: Pushing a Viable Climate Project Around COP27

psince the mid1990s the united nations has been launching global climate summits called cops which stands for conference of the parties last year was the 26th annual summit and took place in glasgow cop26 was supposed to be a pivotal moment for the planet but the outcomes fell way short of the action needed to stop the climate crisis from becoming utterly catastrophic this year cop27 will be held in egypt in the midst of an energy crisis and a war that is reshaping the global orderp pwill cop27 end up as yet another failure on the part of world leaders to slow or stop global warming noam chomsky and robert pollin share their thoughts and insights on the climate crisis conundrum by dissecting the current state of affairs and what ought to be done to stop humanitys march to the climate precipice p pnoam chomsky is institute professor emeritus in the department of linguistics and philosophy at mit and laureate professor of linguistics and agnese nelms haury chair in the program in environmental and social justice at the university of arizona one of the worlds most cited scholars in modern history and a critical public intellectual regarded by millions of people as a national and international treasure chomsky has published more than 150 books in linguistics political and social thought political economy media studies us foreign policy and world affairs and climate change robert pollin is distinguished professor of economics and codirector of the political economy research institute peri at the university of massachusettsamherst one of the worlds leading progressive economists pollin has published scores of books and academic articles on jobs and macroeconomics labor markets wages and poverty environmental and energy economics he was selected by emforeign policy magazineem as one of the 100 leading global thinkers for 2013 chomsky and pollin are coauthors of emclimate crisis and the global green new dealem emthe political economy of saving the planet em2020p pstrongcj polychroniou the 27th session of the conference of the parties cop27 to the united nations framework convention on climate change unfccc will take place in egypt from november 618 2022 nearly 200 countries will come together in yet another attempt to tackle climate breakdown cop26 held in glasgow about the same time last year had been hailed as our last best hope but it did not achieve much as too many compromises were made the hope for cop27 is that the world will set more stringent greenhouse gas emissions reduction requirements considering the everclearer consequences of global warming noam is this a significant climate meeting can we expect a breakthrough or will it end up yet another futile international effort to reverse climate change indeed whats standing on the way of governments failure to slow or even reverse global warming isnt the evidence already overwhelming that the world stands on a climate precipice what prevent us from stepping back from the abyssstrongp pstrongnoam chomsky strongdecisions by governments tend to reflect the distribution of power in the society as adam smith phrased this virtual truism in his classic work the masters of mankind in his day the merchants and manufacturers of england are the principal architects of government policy and act to ensure that their own interests will be most peculiarly attended to no matter how grievous the effects on the general welfare insofar as governments have failed to act in the ways that will prevent catastrophe it is because the principal architects of policy have higher prioritiesp plets take a look the us government has just passed a climate bill a pale shadow of what was proposed by the biden administration under the impact of popular climate activism which in the end could not compete with the power of the true masters in the corporate sector the final shadow is not meaningless it is however radically insufficient in its reach and also burdened with measures to ensure that the interests of the masters are most peculiarly attended top pthe bill that the masters were willing to accept includes vast government subsidies that are alreadyspan spana hrefhttpswwwtexastribuneorg20220808texascarbonrecaptureoccidentalpropertytaxbreaksdriving forwardaspan spanlarge oil and gas projects that threaten a heavy carbon footprint with companies including exxonmobil sempra and occidental petroleum positioned for big payouts the emwashington postem a hrefhttpswwwwashingtonpostcombusiness20221009carboncaptureoilgasutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f38215252f6342ebf1f3d9003c580b00612f5977f250ae7e8a6816e8c2a12f442f722f6342ebf1f3d9003c580b0061wp_cu06c1ed3cde9b8fea92912c222f76477e7cc0dbb844a7922b3de0430100007f44aereportsa one device to satisfy the needs of the masters is a vast wad of money for carbon capture a phrase that means lets keep poisoning the atmosphere freely and maybe someday someone will figure out a way to remove the poisonsp pthats too kind its much worse the irony of carbon capture is that the place it has proven most successful is getting more oil out of the ground all but one major project built in the united states to date is geared toward fossil fuel companies taking the trapped carbon and injecting it into underground wells to extract crudep pthe actual cases would be comical if the consequences were not so grave thus the subsidies give companies lucrative incentives to drill for gas in the most climateunfriendly sites where the concentration of co2 in the fuel is especially high the co2 a potent greenhouse gas is useless for making fuel but the tax credits are awarded based on how many tons of it companies trapp pits hard to believe that this is real but it is its capitalism 101 when the masters are in chargep pother cases illustrate the same priorities arctic permafrost contains huge amounts of carbon and is beginning to melt as the arctic heats much faster than the rest of the world scientists of one oil major conocophillips discovered a way to slow the thawing of the permafrost to what end a hrefhttpswwwnytimescom20210528climatebidenfossilfulesclimatewillowhtmlto keep it solid enough to drill for oil the burning of which will continue to worsen ice melta according to the emnew york timesemp pthe exuberant race to destruction is far more general new fields are being opened to exploration there is a huge expansion of oil pipelines with a hrefhttpswwwtheguardiancomenvironment2022sep27hugeexpansionoilpipelinesendangeringclimatesaysreportmore than 24000km of pipelines planned around world showing an almost deliberate failure to meet climate goalsap asidethe only solution here is mass organizing that is capable of holding all politicians accountableaside pcorporate lobbyists are even pressing states to punish corporations by withdrawing pension funds etc that dare even to provide information on environmental impacts of their policies no stone is left unturned every opportunity to destroy must be exploited no matter how slight following marxs script of capitalism going berserkp pit is not really surprising that once reagan and thatcher launched the current era of savage class war removing all constraints the masters used the opportunity to pursue their vile maxim all for ourselves and nothing for anyone else as smith advised us 250 years agop pthere is a certain logic behind it the rules of the game are that you expand profit and market share or you lose out for selfdelusion it suffices to hold out the thin hope that maybe our technical culture will find some answersp pthere is an alternative to the resolute march toward suicide the distribution of power can be changed by an aroused public with its own very different priorities such as surviving in a livable world the current masters can be controlled on a path toward elimination of their illegitimate authority the rules of the game can be changed in the short term modified sufficiently to enable humankind to adopt the means that have been spelled out in detail to step back from the abyssp pstrongpolychroniou bob can you give us an estimate of where we stand on climate change and what needs to be done for the world to become carbon neutral by 2050strongp pstrongrobert pollin strongwhere we stand with climate change is straightforward and was expressed clearly in the most recent two massive reports of this past february and april 2022 from the intergovernmental panel on climate change ipcc the most authoritative mainstream resource on climate change research in summarizing its february report the ipcc said that humaninduced climate change is causing dangerous and widespread disruption in nature and affecting the lives of billions of people around the world despite efforts to reduce the risks people and ecosystems least able to cope are being hardest hit the a hrefhttpswwwipccchreportsixthassessmentreportworkinggroupiifebruary reporta describes how increased heatwaves droughts and floods are already exceeding plants and animals tolerance thresholds driving mass mortalities in species such as trees and corals these weather extremes are occurring simultaneously causing cascading impacts that are increasingly difficult to manage they have exposed millions of people to acute food and water insecurity especially in africa asia central and south america on small islands and in the arctic i would note that reputable climate scientists a hrefhttpswwwnytimescom20220301climateipccclimatescientistsstrikehtmlregularly criticizea the ipcc for understating our dire ecological conditionp pwhat we need to do to have any chance of stabilizing the climate is also straightforward by far the biggest driver of climate change is burning oil coal and natural gas to produce energy this is because burning fossil fuels to produce energy generates co2 emissions these emissions in turn are the main cause of heat being trapped in our atmosphere and warming the planet this is why in its landmark 2018 special report global warming of 15 celsiusemem the ipcc set out the overarching goals of cutting global co2 emissions by about 50 percent as of 2030 and for the globe to a hrefhttpswwwipccchsr15reach net zero emissions by 2050a the ipcc concluded in the 2018 report and emphasized even more emphatically in its 2022 studies that stabilizing the global climate at 15 degrees celsius 15c above preindustrial average temperature levels is imperative for having any chance of reducing significantly much less preventing the dangerous and widespread disruption in nature affecting the lives of billions of people around the worldp pit is clear then that the single most important project for advancing a viable climate stabilization program is to phase out the consumption of oil coal and natural gas for energy production spanas the fossil fuel energy infrastructure phases out to zero by 2050 we concurrently have to spanbuild an entirely new global energy infrastructure whose centerpieces will be high efficiency and clean renewable energy sources primarily solar and wind powerspan people are obviously still going to need to consume energy from any available source to light heat and cool buildings to power cars buses trains and airplanes and to operate computers and industrial machinery among other uses moreover any minimally decent egalitarian program climate stabilization program what we may call a global green new deal will entail a significant increase in energy consumption for lowerincome people throughout the world spanp pthe other major driver of climate change is corporate industrial agriculture in its multiple manifestations this includes the heavy reliance on natural gasbased fertilizers along with synthetic pesticides and herbicides to increase land productivity it also includes deforestation whose main purpose is to increase available land for cattle grazing and still more industrial farming addressing these causes of climate change is at least in principle also straightforward it requires replacing industrial agriculture with organic farming practices that rely on crop rotation animal manures and composting for fertilizer and biological pest control it means humans eating less beef and thereby freeing up the cattlegrazing land to be used for organic crop cultivation it then also means stopping deforestation most especially in the amazon rainforest ie the earths lungs this is why as noam emphasized in a previous recent interview it is absolutely imperative just on the climate issue alone that lula defeats jair bolsonaro in a hrefhttpstruthoutorgarticlesbrazilsrunoffelectionwillhaveenormouseffectsontheglobalclimatecrisisbrazils presidential electiona on october 30 bolsonaro has no compunctions about obliterating the amazon rainforest if there is money to be made while lula is committed to rainforest preservation and reforestationp asideif we only pay attention to china the us and the european union countries we still are neglecting the countries responsible for generating nearly half of current total global emissionsaside pso in response to both of your questions where we stand today on climate change and what needs to be done we will have a clearer picture after brazils october 30 election we can also generalize from brazils situation that is everywhere in the world we need to elect people like lula and to defeat all climate deniers and apologists for the fossil fuel industry that is all the bolsonaros in all regions of the worldp pat the same time electoral politics by itself is never going to be a sufficient action program even principled political leaders like lula can become susceptible to backsliding from a robust green new deal program in the face of the enormous pressures from fossil fuel corporations who continue to cash in on destroying the planet the only solution here is mass organizing that is capable of holding all politicians accountable there has been tremendous climate activism throughout the world in recent years led by young people this activism simply needs to intensify and continue to become increasingly impactfulp pin terms of some specifics the investments required to dramatically increase energy efficiency standards and equally dramatically expand the global supply of clean energy sources will be a major source of new job creation in all regions of the world spanthis is excellent news as far as it goes but there is no guarantee that these new jobs will be good jobs after all we are still operating within capitalism climate activists therefore need to join forces with unions and other labor organizers to fight for good wages benefits and working conditions for these millions of new clean energy jobs at the same time the phasing out of the global fossil fuel industry will mean largescale losses for workers and communities that are presently dependent on the fossil fuel industry providing a just transition for these workers and communities also needs to be at the center of the global green new deal spanp pspanthere have been some recent positive developments with respect to the energy transition clean renewable energy investments have increased for the past two years at a rate of about 12 percent per year this contrasts sharply with the five years immediately after the major cop21 conference in paris in 2015 during which global clean energy investments rose by a paltry 2 percent annual rate spanp pspanthis recent spike in clean energy investments is being fueled by the fact that the costs of solar and wind power are falling dramatically and are now spana hrefhttpsirenaorgpublications2022julrenewablepowergenerationcostsin2021textglobally2c20new20renewable20capacity20addedat20least20usd205020billionloweraspan than those for fossil fuels and nuclear thus as of 2020 the average cost for spanfossil fuelgenerated electricity ranged between 55148 cents per kilowatt hour in the highincome economies these cost figures then rose sharply in 2021 due to the post covid lockdown supplychain breakdowns in the fossil fuel industry and russias invasion of ukraine by contrast as of 2021 solar photovoltaic installations generate electricity at 48 cents per kilowatt hour and onshore wind is at 33 cents moreover average solar costs fell by roughly 90 percent between 20102021 the average cost figures for solar and wind should continue to decline still further as advances in technology proceed as long as the rapid global expansion of these sectors continuesp pat the same time these positive developments must be weighed against the grim bottomline reality that to date there is still no evidence that global co2 emissions have begun falling a modest reduction did occur in 2020 due to the global covid lockdown but as of 2019 global a hrefhttpsourworldindataorgco2emissionsco2 emissionsa stood at 37 billion tons this is a 50 percent increase relative to 2000 and a 12 percent increase relative to just 2010 overall the transition from a fossil fuel dominant to a highefficiency and renewables dominant global energy infrastructure to rainforest preservation and an organic farming dominant agricultural infrastructure needs to be dramatically accelerated for there to be any chance of hitting the ipccs climate stabilization targetsp pwe also need to recognize that this transition needs to occur everywhere in all countries regardless of their current emissions or income levels this becomes clear through some simple global emissions accounting as of now china and the us are by far most responsible for current total emissions chinas emissions represent 31 percent of the current global total and the united states accounts for another 14 percent so adding emissions from china and the us alone gets us to 45 percent of the global total but we can look at this same statistic from the opposite direction even after combining the emissions levels for china and the us we still havent accounted for fully 55 percent of total global emissions we can then include the emissions totals for the 27 countries of the european union along with china and the us this adds another 8 percent to current total emissions getting us to a hrefhttpsdataworldbankorgindicatorenatmco2ektviewchart53 percent in totala this means that if we only pay attention to china the us and the european union countries we still are neglecting the countries responsible for generating nearly half of current total global emissions the point is that every place does matter if we really are going to hit the target of net zero global emissions by no later than 2050 zero emissions has to really mean emzeroem everywherep pstrongpolychroniou cop27 has been called africas cop indeed africa contributes only 3 percent to greenhouse gas emissions but suffers disproportionately from its negative effects to be sure the issue of who should pay for loss and damages from the climate crisis will occupy center stage at cop27 what are your thoughts on this matter we already know for instance that the eu wont back climate damage funds talks at cop and i dont think we should expect a different attitude from the united states is there a case to be made for climate reparations is there a better alternativestrongp pstrongpollin strongfrom an historical perspective the highincome countries starting with the us but also including canada western europe europe and australia are almost entirely responsible for loading up the atmosphere with greenhouse gas emissions and causing climate change they therefore should be primarily responsible for financing the global green new deal but more recently as i noted above china is producing much larger emissions than any other country china can therefore not be let off the hook as a source of climate financingp pbut we also need to recognize that highincome people in all countries and regions have massively larger carbon footprints than everyone else the average carbon footprint of someone in the richest 10 percent of the global population is 60 times greater than of someone in the poorest 10 percent from this perspective the a hrefhttpswwwcdnoxfamorgs3fspublicfile_attachmentsmbextremecarboninequality021215enpdffinancing of a global green new deala must fall disproportionately on the rich in all countriesp phowever more generally it is not accurate or constructive to consider the issue of financing the energy system transformation as simply a question of who bears how much of the overall burden we also need to recognize that the overall burden is actually not excessively large and that building a global green economy will also generate huge benefits and opportunities consider for example just the followingp ol liaccording to my own research and that of others a global climate stabilization program capable of achieving the zero emissions goal by 2050 will entail clean energy investment spending of roughly 45 trillion per year through 2050 this totals to about 120 trillion over the full period these are eyepopping numbers from one angle yet they amount to an average of only about a hrefhttpswwwversobookscombooks3239climatecrisisandtheglobalgreennewdeal25 percenta of total global income gdp between now and 2050 in other words we can transform the global energy system and save the planet while still spending something like 97 percent of total global income on everything besides clean energy investments this is also while average incomes are rising over timeli licreating a clean global energy infrastructure will pay for itself over time and save money for all energy consumers this is because energy efficiency investments by definition mean spending less money to get the same amount of energy services like keeping ones home welllit and warm in the winter moreover as i noted above the costs of delivering a kilowatt of electricity from renewable energy sources is already lower on average than getting the same kilowatt from fossil fuels or nuclear power sources and the costs of renewable energy are fallingli libuilding the clean energy infrastructure will be more decentralized than the current highly capitalintensive and big corporate dominated fossil fuel infrastructure solar energy systems can be installed on rooftops and parking lots and in ones neighborhood wind turbines can be located on farmland without sacrificing productivity in crop or livestock cultivation this in turn will create opportunities to expand access to energy into lowincome communities throughout the world including in the rural regions of lowincome countries roughly half the people living in these regions do not currently have access to electricity at allli ol poverall then building the global clean energy economy should be understood as a great opportunity for investors and consumers including especially smallscale investors such as both public and private cooperative enterprisesp pthat said it will of course still be necessary to deliver the upfront money to pay for the initial investments there is no shortage of big pots money that can be tapped in equitable ways for this purpose we can start with transferring funds out of military budgets for all countries since the us military budget amounts to 40 percent of global military spending transferring say 5 percent of all military spending into global climate investments will mean that the us share of the funds will also amount to about 40 percent of the global total we can also eliminate existing fossil fuel subsidies in all countries and convert them into clean energy subsidies the central banks of rich countries can purchase green bonds to support investments both within their own countries as well as globally they then will receive the revenues that will be generated by these investments the central banks of rich countries did not hesitate to provide massive bailout funding to financial markets during the covid lockdown at a hrefhttpswwwbostonreviewnetarticlesneoliberalismsbailoutproblemlevels of 10 percent or morea of their countries respective gdps the global green bond fund could amount to perhaps onetenth the size of these bailout programs finally carbon taxes can be a viable source of funds as long as the tax burden falls mostly on highincome consumers and most of the revenue generated by the tax is rebated back to middle and lowincome energy consumersp asidethe financing of a global green new deal must fall disproportionately on the rich in all countriesaside pthe global financing project will then also need to be supported by private investors at a level at least equal to that of government funds yet we know that private investors will never deliver sufficient funds without public policies in place that enforce hard limits on profit opportunities through fossil fuel investments if not eliminating such profit opportunities altogether the a hrefhttpsprospectorgenvironmentnationalizeusfossilfuelindustrytosavetheplanetwindfall tax on oil company profitsa proposed in the us congress by sen sheldon whitehouse and rep ro khanna is one good place to startp pthe need for such measures has become ever clearer since the fiasco surrounding the pledges made by major private financial institutions coming out of last years cop26 climate conference in glasgow perhaps the biggest single story coming out of the glasgow conference was the formation of the glasgow financial alliance for net zero gfanz a group of roughly 500 financial sector firms holding 130 trillion in overall assets ie something like onethird of total global private financial assets at the conference gfanz members committed their institutions to supporting investments that will deliver a zeroemissions global economy by 2050 but now many of the biggest players in the coalition are abandoning their pledges the explanation is simple as reported in a hrefhttpswwwbloombergcomnewsarticles20221014bankstryquietquittingnetzeroasfortunefavorsfossilfuelsembloomberg greenema the revived fortunes of fossil fuels especially coal may explain some of the weakened resolve for decarbonization global bank lending to fossil fuel companies is up 15 percent to over 300 billion in the first nine months of this year from the same period in 2021 justin guay director of climate finance strategy at the sunrise project summed up the matter perfectly in a hrefhttpswwwftcomcontent41b5f34e09b84c208efee9171e37e4d3commentinga banks were happy to sign up to a big pageantry contest at cop26 and get a bunch of applause but when they realized the world expected them to make good on what they said they would do they have looked for convenient excuses to wiggle out of that responsibilityp pstrongpolychroniou noam what do you think about this matter the socalled triple crisis ie responsibility mitigation and adaptation need to be addressed by the countries most responsible for climate breakdown according to both climate activists and various governments of the global south including egypt the host of cop27strongp pstrongchomsky strongwe can refine the question more accurately it is the rich in the rich countries who are most responsible for climate breakdown and much more right now working people in the superrich united states are suffering from severe inflation much of which is caused by the sharp rise in oil prices triggered by the russian invasion of ukraine meanwhile the profits of the fossil fuel industrial complex are booming one shortterm remedy would be a tax on their rapacious pursuit of the vile exam proposed in a hrefhttpswwwbrownsenategovnewsroompressreleasesherrodbrownoilpricegougingrelieflegislation aimed at oil price gouginga introduced by senators sherrod brown and sheldon whitehouse with receipts going directly to consumers much more farreaching steps can easily be envisionedp pthese questions should be considered against the background of the neoliberal class war of the past 40 years which has transferred some 50 trillion to the pockets of the superrich 1 percent bob pollin a hrefhttpswwwthenationcomarticleeconomyinflationfederalreservewagesworkingclassreminds usa that the steady rise in real wages ended in the 70s as the business campaign against working people and the poor was taking shape with the floodgates opened by reagan and thatcher if real wages had continued to track productivity gains the average workers hourly wage in 2021 would have been 6194 not 2518 and if the assault on the public had been curbed big corporate ceo pay would not have risen from being 33 times higher than the average worker in 1978 to 366 times higher in 2019ie a more than a hrefhttpsfilesepiorgpdf204513pdfemtenfoldem increasea in relative pay thats only one part of the serious blows against working people and the poor that we expect on institutional grounds once the reins are cast offp pall of this is background for considering the triple crisis the global green new deal should confront these issues directly and forcefully not just by proper concern for the countries that have been victimized by global warming but also by dismantling the class basis of the depredations of past centuries sometimes taking truly savage forms as in the recent neoliberal yearsp pthe immediate crisis is too urgent for the radical social change that we should seek but efforts to carry it forward should proceed in tandem with addressing urgent demands if basic capitalist institutions remain in place the global green new deal will not proceed as far as it must if we are to have a livable world that values freedom and justicep pstrongpolychroniou the global green new deal may represent our only hope for an effective opportunity to address the challenge of global warming while also setting the world economy on a new course of sustainable development yet it wasnt part of cop26s decarbonization concerns and it doesnt figure in the agenda of cop27 whystrongp pstrongchomsky strongwho meets in the stately halls where agendas are devisedp plets return to our discussion of the achievements of cop26 the most exciting eliciting much euphoria was the commitment of the great private financial institutions to devote up to 130 trillion to such noble projects as wiring africa for solar power the market to the rescue with a small footnote as political economist adam tooze was unkind enough to add the giants of finance will gladly make their lavish contribution to the global green new deal if the international monetary fund and world bank derisk the loans by absorbing losses and there is a carbon price that gives clean energy a competitive advantagep pas long as the vile maxim is firmly in place their munificence has no boundsp pwe return to the same conclusions the global green new deal cannot be delayed but it must go hand in hand with raising consciousness and implementing measures to constrain and ultimately dismantle the institutional structures of capitalist autocracyp pstrongpolychroniou bob you are one of the leading advocates of global green new deal why isnt this project gaining traction too idealistic for the taste of the real world where national interests still reign supreme if so what needs to be donestrongp pstrongpollinstrong as i have tried to convey in my responses above i dont see the global green new deal as idealistic i rather see it as the only viable program that can achieve the ipccs climate stabilization goals in a way that also expands decent job opportunities and raises mass living standards in all regions of the world at all levels of development that includes increasing peoples access to lowcost energy throughout the world as such the global green new deal should attract overwhelming support both among people who are committed around climate issues as well as those whose primary focus may be paying rent and keeping food on the tablep pachieving this level of support can only be achieved through organizing and educating spanto take one example for over a decade labor and environment activists such as those associated with the labor network for sustainability and the bluegreen alliance in the us have been working to build strong coalitions against steep odds they have started to win some significant victories this includes the spana hrefhttpswwwlatimescomopinionstory20211023oilgasjobscleanenergycaliforniaendorsement of a robust green investment and just transition program in californiaaspan by the union representing the states oil refinery workersspanp pspanof course these and similar initiatives face relentless opposition from fossil fuel corporations and the full spectrum of interests aligned with them a clear and coherent global green new deal program will serve as one useful tool in the ongoing struggle to save the planetspanp

psince mid1990s united nations launching global climate summits called cops stands conference parties year 26th annual summit took place glasgow cop26 supposed pivotal moment planet outcomes fell way short action needed stop climate crisis utterly catastrophic year cop27 held egypt midst energy crisis war reshaping global orderp pwill cop27 end failure world leaders slow stop global warming noam chomsky robert pollin share thoughts insights climate crisis conundrum dissecting current state affairs ought stop humanitys march climate precipice p pnoam chomsky institute professor emeritus department linguistics philosophy mit laureate professor linguistics agnese nelms haury chair program environmental social justice university arizona worlds cited scholars modern history critical public intellectual regarded millions people national international treasure chomsky published 150 books linguistics political social thought political economy media studies foreign policy world affairs climate change robert pollin distinguished professor economics codirector political economy research institute peri university massachusettsamherst worlds leading progressive economists pollin published scores books academic articles jobs macroeconomics labor markets wages poverty environmental energy economics selected emforeign policy magazineem 100 leading global thinkers 2013 chomsky pollin coauthors emclimate crisis global green new dealem emthe political economy saving planet em2020p pstrongcj polychroniou 27th session conference parties cop27 united nations framework convention climate change unfccc place egypt november 618 2022 nearly 200 countries come attempt tackle climate breakdown cop26 held glasgow time year hailed best hope achieve compromises hope cop27 world set stringent greenhouse gas emissions reduction requirements considering everclearer consequences global warming noam significant climate meeting expect breakthrough end futile international effort reverse climate change whats standing way governments failure slow reverse global warming isnt evidence overwhelming world stands climate precipice prevent stepping abyssstrongp pstrongnoam chomsky strongdecisions governments tend reflect distribution power society adam smith phrased virtual truism classic work masters mankind day merchants manufacturers england principal architects government policy act ensure interests peculiarly attended matter grievous effects general welfare insofar governments failed act ways prevent catastrophe principal architects policy higher prioritiesp plets look government passed climate bill pale shadow proposed biden administration impact popular climate activism end compete power true masters corporate sector final shadow meaningless radically insufficient reach burdened measures ensure interests masters peculiarly attended pthe bill masters willing accept includes vast government subsidies alreadyspan spana hrefhttpswwwtexastribuneorg20220808texascarbonrecaptureoccidentalpropertytaxbreaksdriving forwardaspan spanlarge oil gas projects threaten heavy carbon footprint companies including exxonmobil sempra occidental petroleum positioned big payouts emwashington postem hrefhttpswwwwashingtonpostcombusiness20221009carboncaptureoilgasutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f38215252f6342ebf1f3d9003c580b00612f5977f250ae7e8a6816e8c2a12f442f722f6342ebf1f3d9003c580b0061wp_cu06c1ed3cde9b8fea92912c222f76477e7cc0dbb844a7922b3de0430100007f44aereportsa device satisfy needs masters vast wad money carbon capture phrase means lets poisoning atmosphere freely maybe someday figure way remove poisonsp pthats kind worse irony carbon capture place proven successful getting oil ground major project built united states date geared fossil fuel companies taking trapped carbon injecting underground wells extract crudep pthe actual cases comical consequences grave subsidies companies lucrative incentives drill gas climateunfriendly sites concentration co2 fuel especially high co2 potent greenhouse gas useless making fuel tax credits awarded based tons companies trapp pits hard believe real capitalism 101 masters chargep pother cases illustrate priorities arctic permafrost contains huge amounts carbon beginning melt arctic heats faster rest world scientists oil major conocophillips discovered way slow thawing permafrost end hrefhttpswwwnytimescom20210528climatebidenfossilfulesclimatewillowhtmlto solid drill oil burning continue worsen ice melta according emnew york timesemp pthe exuberant race destruction far general new fields opened exploration huge expansion oil pipelines hrefhttpswwwtheguardiancomenvironment2022sep27hugeexpansionoilpipelinesendangeringclimatesaysreportmore 24000km pipelines planned world showing deliberate failure meet climate goalsap asidethe solution mass organizing capable holding politicians accountableaside pcorporate lobbyists pressing states punish corporations withdrawing pension funds etc dare provide information environmental impacts policies stone left unturned opportunity destroy exploited matter slight following marxs script capitalism going berserkp pit surprising reagan thatcher launched current era savage class war removing constraints masters opportunity pursue vile maxim smith advised 250 years agop pthere certain logic rules game expand profit market share lose selfdelusion suffices hold thin hope maybe technical culture find answersp pthere alternative resolute march suicide distribution power changed aroused public different priorities surviving livable world current masters controlled path elimination illegitimate authority rules game changed short term modified sufficiently enable humankind adopt means spelled detail step abyssp pstrongpolychroniou bob estimate stand climate change needs world carbon neutral 2050strongp pstrongrobert pollin strongwhere stand climate change straightforward expressed clearly recent massive reports past february april 2022 intergovernmental panel climate change ipcc authoritative mainstream resource climate change research summarizing february report ipcc said humaninduced climate change causing dangerous widespread disruption nature affecting lives billions people world despite efforts reduce risks people ecosystems able cope hardest hit hrefhttpswwwipccchreportsixthassessmentreportworkinggroupiifebruary reporta describes increased heatwaves droughts floods exceeding plants animals tolerance thresholds driving mass mortalities species trees corals weather extremes occurring simultaneously causing cascading impacts increasingly difficult manage exposed millions people acute food water insecurity especially africa asia central south america small islands arctic note reputable climate scientists hrefhttpswwwnytimescom20220301climateipccclimatescientistsstrikehtmlregularly criticizea ipcc understating dire ecological conditionp pwhat need chance stabilizing climate straightforward far biggest driver climate change burning oil coal natural gas produce energy burning fossil fuels produce energy generates co2 emissions emissions turn main cause heat trapped atmosphere warming planet landmark 2018 special report global warming 15 celsiusemem ipcc set overarching goals cutting global co2 emissions 50 percent 2030 globe hrefhttpswwwipccchsr15reach net zero emissions 2050a ipcc concluded 2018 report emphasized emphatically 2022 studies stabilizing global climate 15 degrees celsius 15c preindustrial average temperature levels imperative having chance reducing significantly preventing dangerous widespread disruption nature affecting lives billions people worldp pit clear single important project advancing viable climate stabilization program phase consumption oil coal natural gas energy production spanas fossil fuel energy infrastructure phases zero 2050 concurrently spanbuild entirely new global energy infrastructure centerpieces high efficiency clean renewable energy sources primarily solar wind powerspan people obviously going need consume energy available source light heat cool buildings power cars buses trains airplanes operate computers industrial machinery uses minimally decent egalitarian program climate stabilization program global green new deal entail significant increase energy consumption lowerincome people world spanp pthe major driver climate change corporate industrial agriculture multiple manifestations includes heavy reliance natural gasbased fertilizers synthetic pesticides herbicides increase land productivity includes deforestation main purpose increase available land cattle grazing industrial farming addressing causes climate change principle straightforward requires replacing industrial agriculture organic farming practices rely crop rotation animal manures composting fertilizer biological pest control means humans eating beef freeing cattlegrazing land organic crop cultivation means stopping deforestation especially amazon rainforest ie earths lungs noam emphasized previous recent interview absolutely imperative climate issue lula defeats jair bolsonaro hrefhttpstruthoutorgarticlesbrazilsrunoffelectionwillhaveenormouseffectsontheglobalclimatecrisisbrazils presidential electiona october 30 bolsonaro compunctions obliterating amazon rainforest money lula committed rainforest preservation reforestationp asideif pay attention china european union countries neglecting countries responsible generating nearly half current total global emissionsaside pso response questions stand today climate change needs clearer picture brazils october 30 election generalize brazils situation world need elect people like lula defeat climate deniers apologists fossil fuel industry bolsonaros regions worldp pat time electoral politics going sufficient action program principled political leaders like lula susceptible backsliding robust green new deal program face enormous pressures fossil fuel corporations continue cash destroying planet solution mass organizing capable holding politicians accountable tremendous climate activism world recent years led young people activism simply needs intensify continue increasingly impactfulp pin terms specifics investments required dramatically increase energy efficiency standards equally dramatically expand global supply clean energy sources major source new job creation regions world spanthis excellent news far goes guarantee new jobs good jobs operating capitalism climate activists need join forces unions labor organizers fight good wages benefits working conditions millions new clean energy jobs time phasing global fossil fuel industry mean largescale losses workers communities presently dependent fossil fuel industry providing transition workers communities needs center global green new deal spanp pspanthere recent positive developments respect energy transition clean renewable energy investments increased past years rate 12 percent year contrasts sharply years immediately major cop21 conference paris 2015 global clean energy investments rose paltry 2 percent annual rate spanp pspanthis recent spike clean energy investments fueled fact costs solar wind power falling dramatically spana hrefhttpsirenaorgpublications2022julrenewablepowergenerationcostsin2021textglobally2c20new20renewable20capacity20addedat20least20usd205020billionloweraspan fossil fuels nuclear 2020 average cost spanfossil fuelgenerated electricity ranged 55148 cents kilowatt hour highincome economies cost figures rose sharply 2021 post covid lockdown supplychain breakdowns fossil fuel industry russias invasion ukraine contrast 2021 solar photovoltaic installations generate electricity 48 cents kilowatt hour onshore wind 33 cents average solar costs fell roughly 90 percent 20102021 average cost figures solar wind continue decline advances technology proceed long rapid global expansion sectors continuesp pat time positive developments weighed grim bottomline reality date evidence global co2 emissions begun falling modest reduction occur 2020 global covid lockdown 2019 global hrefhttpsourworldindataorgco2emissionsco2 emissionsa stood 37 billion tons 50 percent increase relative 2000 12 percent increase relative 2010 overall transition fossil fuel dominant highefficiency renewables dominant global energy infrastructure rainforest preservation organic farming dominant agricultural infrastructure needs dramatically accelerated chance hitting ipccs climate stabilization targetsp pwe need recognize transition needs occur countries regardless current emissions income levels clear simple global emissions accounting china far responsible current total emissions chinas emissions represent 31 percent current global total united states accounts 14 percent adding emissions china gets 45 percent global total look statistic opposite direction combining emissions levels china havent accounted fully 55 percent total global emissions include emissions totals 27 countries european union china adds 8 percent current total emissions getting hrefhttpsdataworldbankorgindicatorenatmco2ektviewchart53 percent totala means pay attention china european union countries neglecting countries responsible generating nearly half current total global emissions point place matter going hit target net zero global emissions later 2050 zero emissions mean emzeroem everywherep pstrongpolychroniou cop27 called africas cop africa contributes 3 percent greenhouse gas emissions suffers disproportionately negative effects sure issue pay loss damages climate crisis occupy center stage cop27 thoughts matter know instance eu wont climate damage funds talks cop dont think expect different attitude united states case climate reparations better alternativestrongp pstrongpollin strongfrom historical perspective highincome countries starting including canada western europe europe australia entirely responsible loading atmosphere greenhouse gas emissions causing climate change primarily responsible financing global green new deal recently noted china producing larger emissions country china let hook source climate financingp pbut need recognize highincome people countries regions massively larger carbon footprints average carbon footprint richest 10 percent global population 60 times greater poorest 10 percent perspective hrefhttpswwwcdnoxfamorgs3fspublicfile_attachmentsmbextremecarboninequality021215enpdffinancing global green new deala fall disproportionately rich countriesp phowever generally accurate constructive consider issue financing energy system transformation simply question bears overall burden need recognize overall burden actually excessively large building global green economy generate huge benefits opportunities consider example followingp ol liaccording research global climate stabilization program capable achieving zero emissions goal 2050 entail clean energy investment spending roughly 45 trillion year 2050 totals 120 trillion period eyepopping numbers angle average hrefhttpswwwversobookscombooks3239climatecrisisandtheglobalgreennewdeal25 percenta total global income gdp 2050 words transform global energy system save planet spending like 97 percent total global income clean energy investments average incomes rising timeli licreating clean global energy infrastructure pay time save money energy consumers energy efficiency investments definition mean spending money energy services like keeping ones home welllit warm winter noted costs delivering kilowatt electricity renewable energy sources lower average getting kilowatt fossil fuels nuclear power sources costs renewable energy fallingli libuilding clean energy infrastructure decentralized current highly capitalintensive big corporate dominated fossil fuel infrastructure solar energy systems installed rooftops parking lots ones neighborhood wind turbines located farmland sacrificing productivity crop livestock cultivation turn create opportunities expand access energy lowincome communities world including rural regions lowincome countries roughly half people living regions currently access electricity allli ol poverall building global clean energy economy understood great opportunity investors consumers including especially smallscale investors public private cooperative enterprisesp pthat said course necessary deliver upfront money pay initial investments shortage big pots money tapped equitable ways purpose start transferring funds military budgets countries military budget amounts 40 percent global military spending transferring 5 percent military spending global climate investments mean share funds 40 percent global total eliminate existing fossil fuel subsidies countries convert clean energy subsidies central banks rich countries purchase green bonds support investments countries globally receive revenues generated investments central banks rich countries hesitate provide massive bailout funding financial markets covid lockdown hrefhttpswwwbostonreviewnetarticlesneoliberalismsbailoutproblemlevels 10 percent morea countries respective gdps global green bond fund onetenth size bailout programs finally carbon taxes viable source funds long tax burden falls highincome consumers revenue generated tax rebated middle lowincome energy consumersp asidethe financing global green new deal fall disproportionately rich countriesaside pthe global financing project need supported private investors level equal government funds know private investors deliver sufficient funds public policies place enforce hard limits profit opportunities fossil fuel investments eliminating profit opportunities altogether hrefhttpsprospectorgenvironmentnationalizeusfossilfuelindustrytosavetheplanetwindfall tax oil company profitsa proposed congress sen sheldon whitehouse rep ro khanna good place startp pthe need measures clearer fiasco surrounding pledges major private financial institutions coming years cop26 climate conference glasgow biggest single story coming glasgow conference formation glasgow financial alliance net zero gfanz group roughly 500 financial sector firms holding 130 trillion overall assets ie like onethird total global private financial assets conference gfanz members committed institutions supporting investments deliver zeroemissions global economy 2050 biggest players coalition abandoning pledges explanation simple reported hrefhttpswwwbloombergcomnewsarticles20221014bankstryquietquittingnetzeroasfortunefavorsfossilfuelsembloomberg greenema revived fortunes fossil fuels especially coal explain weakened resolve decarbonization global bank lending fossil fuel companies 15 percent 300 billion months year period 2021 justin guay director climate finance strategy sunrise project summed matter perfectly hrefhttpswwwftcomcontent41b5f34e09b84c208efee9171e37e4d3commentinga banks happy sign big pageantry contest cop26 bunch applause realized world expected good said looked convenient excuses wiggle responsibilityp pstrongpolychroniou noam think matter socalled triple crisis ie responsibility mitigation adaptation need addressed countries responsible climate breakdown according climate activists governments global south including egypt host cop27strongp pstrongchomsky strongwe refine question accurately rich rich countries responsible climate breakdown right working people superrich united states suffering severe inflation caused sharp rise oil prices triggered russian invasion ukraine profits fossil fuel industrial complex booming shortterm remedy tax rapacious pursuit vile exam proposed hrefhttpswwwbrownsenategovnewsroompressreleasesherrodbrownoilpricegougingrelieflegislation aimed oil price gouginga introduced senators sherrod brown sheldon whitehouse receipts going directly consumers farreaching steps easily envisionedp pthese questions considered background neoliberal class war past 40 years transferred 50 trillion pockets superrich 1 percent bob pollin hrefhttpswwwthenationcomarticleeconomyinflationfederalreservewagesworkingclassreminds usa steady rise real wages ended 70s business campaign working people poor taking shape floodgates opened reagan thatcher real wages continued track productivity gains average workers hourly wage 2021 6194 2518 assault public curbed big corporate ceo pay risen 33 times higher average worker 1978 366 times higher 2019ie hrefhttpsfilesepiorgpdf204513pdfemtenfoldem increasea relative pay thats blows working people poor expect institutional grounds reins cast offp pall background considering triple crisis global green new deal confront issues directly forcefully proper concern countries victimized global warming dismantling class basis depredations past centuries taking truly savage forms recent neoliberal yearsp pthe immediate crisis urgent radical social change seek efforts carry forward proceed tandem addressing urgent demands basic capitalist institutions remain place global green new deal proceed far livable world values freedom justicep pstrongpolychroniou global green new deal represent hope effective opportunity address challenge global warming setting world economy new course sustainable development wasnt cop26s decarbonization concerns doesnt figure agenda cop27 whystrongp pstrongchomsky strongwho meets stately halls agendas devisedp plets return discussion achievements cop26 exciting eliciting euphoria commitment great private financial institutions devote 130 trillion noble projects wiring africa solar power market rescue small footnote political economist adam tooze unkind add giants finance gladly lavish contribution global green new deal international monetary fund world bank derisk loans absorbing losses carbon price gives clean energy competitive advantagep pas long vile maxim firmly place munificence boundsp pwe return conclusions global green new deal delayed hand hand raising consciousness implementing measures constrain ultimately dismantle institutional structures capitalist autocracyp pstrongpolychroniou bob leading advocates global green new deal isnt project gaining traction idealistic taste real world national interests reign supreme needs donestrongp pstrongpollinstrong tried convey responses dont global green new deal idealistic viable program achieve ipccs climate stabilization goals way expands decent job opportunities raises mass living standards regions world levels development includes increasing peoples access lowcost energy world global green new deal attract overwhelming support people committed climate issues primary focus paying rent keeping food tablep pachieving level support achieved organizing educating spanto example decade labor environment activists associated labor network sustainability bluegreen alliance working build strong coalitions steep odds started win significant victories includes spana hrefhttpswwwlatimescomopinionstory20211023oilgasjobscleanenergycaliforniaendorsement robust green investment transition program californiaaspan union representing states oil refinery workersspanp pspanof course similar initiatives face relentless opposition fossil fuel corporations spectrum interests aligned clear coherent global green new deal program serve useful tool ongoing struggle save planetspanp

63560e433aa0fa99976324d3

The old problem with the young: Biden courts elusive voting bloc

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden is aggressively pursuing younger voters leaning into the issues of reproductive rights and student loan forgiveness in an effort to drive to the polls a bloc that traditionally sees lower turnoutp phistorically weve had a problem with younger voters falling off during the midterms said democratic strategist rodell mollineau who served as an aide to the late senate majority leader harry reid dnevp pyes it may be about his legacy and his standing and positioning for 2024 but the main beneficiary right now are candidates in close races that are going to need every single vote and that means turning out young people p pbiden took a victory lap friday on his student loan forgiveness plan after applications officially opened on monday with a relnoreferrer noopener dataidhttpsthehillcomhomenewsadministration3698984bidensaysalmost22millionamericanshaveappliedforstudentloanforgiveness hrefhttpsthehillcomhomenewsadministration3698984bidensaysalmost22millionamericanshaveappliedforstudentloanforgiveness datatypeurl target_blank22 million americans applying so fara he told a group at delaware state university i will never apologize for helping working and middleclass americansp pthe president earlier this week focused on reproductive rights issues pledging at the howard theater in washington that he would make a bill to codify abortion access his top legislative priority if democrats retain their majorities in congressp pin focusing on these issues hes appealing to a significant portion of the voting population said nayerra haq who served as an official in the obama administration any politician who wants to win or serve the public needs to realize this is the demographic they should be addressing p phaq said millennials are the first generation that will not be able to advance beyond their parents because of the flaws in our economic systemp pthat requires systemic solutions and thats what biden is doing she added  p pyoung people typically dont show up in large numbers for midterm elections in 2018 only 36 percent of 18 to 29 year olds voted which was still a huge improvement from the 20 percent turnout in 2014 according to the us census bureaup pwith three weeks before the midterm elections the administration opened applications for its student loan proposal which is set to forgive up to 10000 in federal debt for borrowers earning less than 125000 and as much as 20000 for borrowers who received pell grantsp pthe plan has been hit with multiple lawsuits and on friday a relnoreferrer noopener dataidhttpsthehillcomregulationcourtbattles3699170federalappealscourttemporarilyblocksbidenstudentloanforgivenessprogram hrefhttpsthehillcomregulationcourtbattles3699170federalappealscourttemporarilyblocksbidenstudentloanforgivenessprogram datatypeurl target_blanka federal appeals court ruleda that it should be temporarily put on hold as a gop challenge plays outp psteve schale the prominent political strategist who ran former president obamas campaign operation in florida in 2008 called bidens efforts a big deal p pstudent loan debt is a significant issue among young people schale said hes talking to a segment of the electoratep pbiden has also been bringing up his marijuana policies more often telling the audiences at both delaware state university and the howard theater this week that he is keeping his promise that no one should be in jail for using or possessing marijuanap pdemocrats applaud bidens focus on issues centering around marijuana and child care both of which are important to young votersp pquotnow he can be delivering on those bigger ticket items that are necessary for generational changequot haq said referring to both issues p pbiden has focused much of his attention on the economy which has consistently polled as the most topofmind issue among voters this cycle amid high inflation and gas prices the president for months has been tasked with trying to prove to americans that he cares about costs and is working to get them downp pbut a relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3697137mostinnewpollsaybidennotpayingenoughattentiontomostimportantissues target_blanknew polling this weekaa hrefhttpsthehillcomhomenewsadministration3697137mostinnewpollsaybidennotpayingenoughattentiontomostimportantissues showed that 63 percenta of americans still wish biden would give more attention to their top issues with inflation topping that list other top issues included immigration and crime two areas where republicans have bashed democratsp pthe focus on young people also comes as support for democratic candidates among independent voters appears to be waningp pindependent women who are a pivotal voting bloc this cycle following the supreme court decision to overturn roe v wade are leaning more towards republicans recently polling released on monday showed the bloc favored republicans by 18 points which is a sizable increase since septemberp pthe democratic national committee dnc and the white house did not respond to the hills request for comment about the timing of the presidents recent focus on issues that attract young peoplep pbidens strategy seems to be twofold to highlight initiatives popular with younger voters for the midterms and to solidify younger voter support going forward he is drawing a clear distinction between democratic and gop principles that he hopes will enhance dem turnout in 2022 and in the years moving forward said former rep chris carney dpa a biden allyp pboth reproductive rights and student loan forgiveness poll well among young voters and biden sees those issues as bringing fresh traditionally lessinvolved midterm voters to the polls in november carney addedp pwhile young voters helped catapult biden to the white house in 2020 his numbers with the demographic have fallen during his presidency an nprpbs newshour poll out in july showed that just 5 percent of voters under the age of 45 strongly approve of bidens performance p pstrategists attribute the problem partly to a generational gap between biden and the demographic but at the same time as one progressive strategist pointed out bernie sanders and elizabeth warren havent had that problem ever p pthey were both very much in touch with the needs of these younger voters the strategist said in fact i think bernie was boosted by this demographic p pxochitl hinojosa former communications director at the dnc argued that issues like student loans and abortion go beyond young people and appeals to voters of all agesp pthe president has been laser focused on the issues important to voters and yes those do include gas prices and student loans as well as reproductive rights many of these issues not only target young voters but the broader electorate hinojosa said americans want to hear directly from their president about how he is going to tackle the issues confronting our nation and thats exactly what hes doingp pwhile the president is reaching out to young voters so are other democrats p pnew york rep alexandria ocasiocortez a millennial herself is rallying students at the university of california irvine on sunday meanwhile sanders is using his star power with young people to help democrats in nevada florida wisconsin and pennsylvania heading to those senate battleground states before election dayp pyoure building a coalition schale said adding that our coalition requires younger voters to get a winp pthe president leaned further into his support for abortion access this week when he said in an interview that he a relnoreferrer noopener dataidhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupport hrefhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupport datatypeurl target_blankwould support a federal fuaa hrefhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupportnd to help patients paya for the procedure reaffirming his stance against the hyde amendment which prohibits federal funds from being used to pay for abortionsp phis support for federal funding follows months of backlash over whether the white house has done enough in the wake of the supreme courts decision when roe was first overturned in june the president faced fierce criticism for moving too slowly on actions to help protect accessp pbut the white house has seen some success since then particularly when it comes to legislation that passed over the summer p pschale said biden has much to tout in the final weeks on the campaign trail p p if ive had any criticism of the administration its that we havent done a good job telling the success stories and yes they should lean into it he said our coalition requires younger voters to get a win we should go tell the story we have a good story and im glad they arep

figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure ppresident biden aggressively pursuing younger voters leaning issues reproductive rights student loan forgiveness effort drive polls bloc traditionally sees lower turnoutp phistorically weve problem younger voters falling midterms said democratic strategist rodell mollineau served aide late senate majority leader harry reid dnevp pyes legacy standing positioning 2024 main beneficiary right candidates close races going need single vote means turning young peoplep pbiden took victory lap friday student loan forgiveness plan applications officially opened monday relnoreferrer noopener dataidhttpsthehillcomhomenewsadministration3698984bidensaysalmost22millionamericanshaveappliedforstudentloanforgiveness hrefhttpsthehillcomhomenewsadministration3698984bidensaysalmost22millionamericanshaveappliedforstudentloanforgiveness datatypeurl target_blank22 million americans applying fara told group delaware state university apologize helping working middleclass americansp pthe president earlier week focused reproductive rights issues pledging howard theater washington bill codify abortion access legislative priority democrats retain majorities congressp pin focusing issues hes appealing significant portion voting population said nayerra haq served official obama administration politician wants win serve public needs realize demographic addressingp phaq said millennials generation able advance parents flaws economic systemp pthat requires systemic solutions thats biden addedp pyoung people typically dont large numbers midterm elections 2018 36 percent 18 29 year olds voted huge improvement 20 percent turnout 2014 according census bureaup pwith weeks midterm elections administration opened applications student loan proposal set forgive 10000 federal debt borrowers earning 125000 20000 borrowers received pell grantsp pthe plan hit multiple lawsuits friday relnoreferrer noopener dataidhttpsthehillcomregulationcourtbattles3699170federalappealscourttemporarilyblocksbidenstudentloanforgivenessprogram hrefhttpsthehillcomregulationcourtbattles3699170federalappealscourttemporarilyblocksbidenstudentloanforgivenessprogram datatypeurl target_blanka federal appeals court ruleda temporarily hold gop challenge plays outp psteve schale prominent political strategist ran president obamas campaign operation florida 2008called bidens efforts big dealp pstudent loan debt significant issue young people schale said hes talking segment electoratep pbiden bringing marijuana policies telling audiences delaware state university howard theater week keeping promise jail possessing marijuanap pdemocrats applaud bidens focus issues centering marijuana child care important young votersp pquotnow delivering bigger ticket items necessary generational changequot haq said referring issuesp pbiden focused attention economy consistently polled topofmind issue voters cycle amid high inflation gas prices president months tasked trying prove americans cares costs working downp pbuta relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3697137mostinnewpollsaybidennotpayingenoughattentiontomostimportantissues target_blanknew polling weekaa hrefhttpsthehillcomhomenewsadministration3697137mostinnewpollsaybidennotpayingenoughattentiontomostimportantissuesshowed 63 percenta americans wish biden attention issues inflation topping list issues included immigration crime areas republicans bashed democratsp pthe focus young people comes support democratic candidates independent voters appears waningp pindependent women pivotal voting bloc cycle following supreme court decision overturn roe v wade leaning republicans recently polling released monday showed bloc favored republicans 18 points sizable increase septemberp pthe democratic national committee dnc white house respond hills request comment timing presidents recent focus issues attract young peoplep pbidens strategy twofold highlight initiatives popular younger voters midterms solidify younger voter support going forward drawing clear distinction democratic gop principles hopes enhance dem turnout 2022 years moving forward said rep chris carney dpa biden allyp pboth reproductive rights student loan forgiveness poll young voters biden sees issues bringing fresh traditionally lessinvolved midterm voters polls november carney addedp pwhile young voters helped catapult biden white house 2020 numbers demographic fallen presidency nprpbs newshour poll july showed 5 percent voters age 45 strongly approve bidens performancep pstrategists attribute problem partly generational gap biden demographic time progressive strategist pointed bernie sanders elizabeth warren havent problem everp pthey touch needs younger voters strategist said fact think bernie boosted demographicp pxochitl hinojosa communications director dnc argued issues like student loans abortion young people appeals voters agesp pthe president laser focused issues important voters yes include gas prices student loans reproductive rights issues target young voters broader electorate hinojosa saidamericans want hear directly president going tackle issues confronting nation thats exactly hes doingp pwhile president reaching young voters democratsp pnew york rep alexandria ocasiocortez millennial rallying students university california irvine sunday sanders star power young people help democrats nevada florida wisconsin pennsylvania heading senate battleground states election dayp pyoure building coalition schale said adding coalition requires younger voters winp pthe president leaned support abortion access week said interview relnoreferrer noopener dataidhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupport hrefhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupport datatypeurl target_blankwould support federal fuaa hrefhttpsthehillcomhomenewsadministration3696875bidenbacksfederalfundforabortionsupportnd help patients paya procedure reaffirming stance hyde amendment prohibits federal funds pay abortionsp phis support federal funding follows months backlash white house wake supreme courts decision roe overturned june president faced fierce criticism moving slowly actions help protect accessp pbut white house seen success particularly comes legislation passed summerp pschale said biden tout final weeks campaign trailp p ive criticism administration havent good job telling success stories yes lean said coalition requires younger voters win tell story good story im glad arep

63560ed53aa0fa99976324ea

A Better Read on the Economy

pimg width736 alt srchttpss3freebeaconcomup2022109781538167397_736x514jpg height514pptheres an entire genre of quotthings are better than you thinkquot books stretching back at least a couple decades in these sunny tomes academics push back against pessimistic claims that for example middleclass incomes are stagnant the poor are getting poorer and inequality is exploding thanks to the gains of the evil top 1 percent think iits getting better all the timei from stephen moore and julian l simon imyths of rich and poori from w michael cox and richard alm ifactfulnessi from hans rosling a relnoopener hrefhttpsfreebeaconcomcultureenlightenmentmeh target_blankienlightenment nowi from steven pinkera and ithe american dream is not deadi from michael strainp pjoining them is ithe myth of american inequalityi from former senator phil gramm and coauthors robert ekelund and john early all three of them economists the us government is getting key concepts all wrong they say including income inflation poverty and inequality they detail how some oftencited metrics are calculatedand how various corrections change the numbersp pit turns out things are better than you thinkp pkidding aside this is an impressive clearly written book that can introduce everyday readers to the sausagemaking process behind the numbers they see cited in the media it also leaves room for disagreement about the authors corrections to the official estimates as well as their policy recommendationsp pthe books core is a series of chapters taking on numerous concepts the government tries to measurep pincome theyre counting only cash incomeleaving out inkind transfers like food stamps and employer benefits as well as failing to subtract taxes inflation theyre overestimating it which means they assume more of our gains are eaten up by rising prices than is really the case both of these problems meanwhile affect the measurement of poverty which depends on whether a familys income exceeds a threshold that is adjusted for inflation over time inequality also hinges on what is counted as income and to make matters worse international comparisons are sullied by the census bureaus failure to conform to the reporting rules other countries follow these arent wild conspiracy theories theyre backed up with careful explanations and citations and for the most part already well known to people who follow these academic debatesp peven more interesting is the authors attempt to present a fresh picture of american households financesboth in terms of the current income distribution and in terms of trends over timeby accounting for problems like thesep pranking households by their earned income including employerpaid benefits and investment income theres a 60to1 disparity between the top 20 percent and the bottom 20 percent the official census bureau numbers including all cash income put the disparity at about 17 to 1 but add in all transfers and subtract taxes and the gap shrinks to 4 to 1p pgovernment transfers to the lowestearning quintile are enormous totaling about 45000 per householdabout 19000 from oldage entitlements 2500 from disability 10000 from medicaid and the childrens health insurance program and 1500 from food stamps plus 13000 from other programs the mix is different for elderly and nonelderly households but the authors report very similar total results when the elderly are excluded with bottomquintile nonelderly households also receiving about 45000 in totalp pindeed by gramm et als calculations the bottom 60 percent of households have been made startlingly equal the bottom 20 percent end up with roughly 50000 after taxes and transfers versus 54000 for the second quintile and 66000 for the middle one if one further adjusts for household size the lowest income quintile slightly ibeatsi the secondlowest which works more but sees less government largesse and has more mouths to feedp pregarding poverty the official rate has stayed within a narrow range of about 10 percent to 15 percent for decades but when the authors add in government benefits the official measure fails to count the rate is more like 3 percent and it falls even lower if the inflation adjustment is improved as well gramm et al also cite work from bruce d meyer and james x sullivan that reached similar numbers by measuring poverty based on consumption rather than incomep phas inequality been rising over time yes in terms of earned income for a number of reasons lowerskilled men have been working less higherskilled women have been working more and marrying similarly highearning men the returns to education have increased etc but growing redistribution has counterbalanced these trendsand simultaneously encouraged declining earnings at the bottom by promising benefits to people who dont workp pthings are better than you think but they could be better still as the authors urge policymakers to enact a suite of reforms to improve opportunity these include broader use of work requirements for government aid which will probably be the most contentious aspect of the book among the left a central thrust of the authors empirical analysis after all is that counting antipoverty spending as income makes things look a lot betterand then they turn around and recommend cutting antipoverty spending because its unfair for people to have similar incomes despite large differences in work effortp psuch reforms could increase work as shown by the 1996 welfare reform and there is also a strong moral case that taxpayers shouldnt support people who refuse to help themselves at the same time given the results presented in this book even a reformed safety net will likely need to achieve substantial redistribution to keep poverty and inequality for those worried about it suppressedp pgramm and his coauthors are correct in their central claim official government statistics measure things in odd and inaccurate ways and on balance this tends to make things look worse than they are those who follow academic work on these topics and read the other books in this genre have known this for yearsp pbut its also worth flagging that however clear it is that the official numbers are skewed quotunskewingquot the data is at least as much art as science with numerous debates about which adjustments to make gramm et al explain what they do clearly and provide additional documentation for those who want to dig in but readers should think about the consequences of each decisionp ptake for instance the authors finding of an eerie income equality among the bottom 60 percent after adjusting for taxes transfers and household size to the point that the bottom quintile makes slightly imorei than the next group up a lowerincome group has higher income than a higherincome groupa quotblockbusterquot findingp pthis is possible because the authors rank households according to their earned income then recalculate each groups income with the adjustments if a single elderly man has little to no earned income but more than 50000 in social security and medicare benefits hes placed in the very bottom tier of society and then the adjustments help to make that bottom tier look welloff but one can argue for redoing ithe rankings themselvesi with the adjustments too in which case that man wouldnt be assigned to the bottom tier to begin with and it would be mathematically impossible for a lower quintile to have higher income than a higher one this case is easiest to make with the householdsize adjustment which reflects basic economic realities rather than policy and oldage benefits which differ in kind from other government transfersp pother subjective decisions abound for instance how does one place a value on public health care benefits which are an enormous proportion of government spending on both the a relnoopener hrefhttpswwwcbogovpublication58270 target_blankelderlya and the a relnoopener hrefhttpswwwheritageorgsitesdefaultfilesinlineimagesbgwelfarespending2018allchartspage2825gif target_blankpoora and thus can dramatically change the numbers the authors value health benefits at the amount the government pays for medical services they present this as a conservative choice because the government underpays for these services forcing providers to charge higher rates to the privately insured and because their measure does not include the programs administrative costs if the government paid 2000 for someones medical care that person received 2000 in government benefits fair enoughp pon the other hand you cant eat medicaid unlike say food stamps this spending does not function anything like cash for the folks on these programs it doesnt necessarily improve their wellbeing in a dollarfordollar fashion and the benefits are something of a lotteryinvaluable for those who fall severely ill helpful for those who avoid outofpocket costs or get routine care theyd otherwise skip and just some peace of mind otherwise its a judgment call whether and how to account for these issues in a 2016 report for instance scott winship decided to value medical benefits at onequarter of their quotmarket valuequot as determined by the census bureau see the discussion of the issue in appendix 1 a relnoopener hrefhttpswwwmanhattaninstituteorghtmlpovertyafterwelfarereformhtml target_blankhereap pcorrecting the poverty rate is also fraught with difficulties in measuring trends over time the rate should obviously consider government benefits and properly account for inflation but what standard of living should the poverty line represent if we start at the onset of the war on poverty with roughly a fifth of americans officially considered poor and just track improvement from there we can say that a relnoopener hrefhttpsfreebeaconcomissuesceawevewonlbjswaronpoverty target_blankthe war is over and we wona hardly anyone is poor by mid1960s standards anymorep pbut as standards of living rise in general should our sense of what it means to be poor change as well a relnoopener hrefhttpstwittercomdavebrady72status1363972784112635906langca target_blankcritics noteda that the aforementioned a relnoopener hrefhttpswwwaeiorgresearchproductsreportannualreportonusconsumptionpoverty2017 target_blankmeyersullivan consumption measuresa which suggest a poverty rate of around 3 percent in the late 2010s were quotanchoredquot to the official poverty rate in 1980 as a result the late2010s poverty thresholds were just 13000 to 18000 for a family of four with the exact number varying across measures anchoring to 2015 as meyer and sullivan also did in their reports instead raises the poverty rate to about 12 percent and the thresholds by more than 5000 each the supplemental poverty measure the census bureaus own attempt to create a poverty metric that actually makes sense has similarly classified a relnoopener hrefhttpswwwcensusgovlibrarystories202201nationalpovertyinamericaawarenessmonthmeasuringpovertyhtml target_blankaround a 10th of americans as poora in recent yearsp pthere are any number of ways to fix the official numbers and gramm et als approach is just one of them but they have done a stellar job of critiquing the statistics at the heart of so many economic debates and providing a thoughtprovoking alternativep pithe myth of american inequality how government biases policy debateibr by phil gramm robert ekelund and john earlybr rowman amp littlefield 255 pp 2995p pirobert verbruggen is a fellow at the manhattan instituteip pthe post a relnofollow hrefhttpsfreebeaconcompolicyabetterreadontheeconomya better read on the economya appeared first on a relnofollow hrefhttpsfreebeaconcomwashington free beaconap

pimg width736 alt srchttpss3freebeaconcomup2022109781538167397_736x514jpg height514pptheres entire genre quotthings better thinkquot books stretching couple decades sunny tomes academics push pessimistic claims example middleclass incomes stagnant poor getting poorer inequality exploding thanks gains evil 1 percent think iits getting better timei stephen moore julian l simon imyths rich poori w michael cox richard alm ifactfulnessi hans rosling relnoopener hrefhttpsfreebeaconcomcultureenlightenmentmeh target_blankienlightenment nowi steven pinkera ithe american dream deadi michael strainp pjoining ithe myth american inequalityi senator phil gramm coauthors robert ekelund john early economists government getting key concepts wrong including income inflation poverty inequality detail oftencited metrics calculatedand corrections change numbersp pit turns things better thinkp pkidding aside impressive clearly written book introduce everyday readers sausagemaking process numbers cited media leaves room disagreement authors corrections official estimates policy recommendationsp pthe books core series chapters taking numerous concepts government tries measurep pincome theyre counting cash incomeleaving inkind transfers like food stamps employer benefits failing subtract taxes inflation theyre overestimating means assume gains eaten rising prices case problems affect measurement poverty depends familys income exceeds threshold adjusted inflation time inequality hinges counted income matters worse international comparisons sullied census bureaus failure conform reporting rules countries follow arent wild conspiracy theories theyre backed careful explanations citations known people follow academic debatesp peven interesting authors attempt present fresh picture american households financesboth terms current income distribution terms trends timeby accounting problems like thesep pranking households earned income including employerpaid benefits investment income theres 60to1 disparity 20 percent 20 percent official census bureau numbers including cash income disparity 17 1 add transfers subtract taxes gap shrinks 4 1p pgovernment transfers lowestearning quintile enormous totaling 45000 householdabout 19000 oldage entitlements 2500 disability 10000 medicaid childrens health insurance program 1500 food stamps plus 13000 programs mix different elderly nonelderly households authors report similar total results elderly excluded bottomquintile nonelderly households receiving 45000 totalp pindeed gramm et als calculations 60 percent households startlingly equal 20 percent end roughly 50000 taxes transfers versus 54000 second quintile 66000 middle adjusts household size lowest income quintile slightly ibeatsi secondlowest works sees government largesse mouths feedp pregarding poverty official rate stayed narrow range 10 percent 15 percent decades authors add government benefits official measure fails count rate like 3 percent falls lower inflation adjustment improved gramm et al cite work bruce d meyer james x sullivan reached similar numbers measuring poverty based consumption incomep phas inequality rising time yes terms earned income number reasons lowerskilled men working higherskilled women working marrying similarly highearning men returns education increased etc growing redistribution counterbalanced trendsand simultaneously encouraged declining earnings promising benefits people dont workp pthings better think better authors urge policymakers enact suite reforms improve opportunity include broader use work requirements government aid probably contentious aspect book left central thrust authors empirical analysis counting antipoverty spending income makes things look lot betterand turn recommend cutting antipoverty spending unfair people similar incomes despite large differences work effortp psuch reforms increase work shown 1996 welfare reform strong moral case taxpayers shouldnt support people refuse help time given results presented book reformed safety net likely need achieve substantial redistribution poverty inequality worried suppressedp pgramm coauthors correct central claim official government statistics measure things odd inaccurate ways balance tends things look worse follow academic work topics read books genre known yearsp pbut worth flagging clear official numbers skewed quotunskewingquot data art science numerous debates adjustments gramm et al explain clearly provide additional documentation want dig readers think consequences decisionp ptake instance authors finding eerie income equality 60 percent adjusting taxes transfers household size point quintile makes slightly imorei group lowerincome group higher income higherincome groupa quotblockbusterquot findingp pthis possible authors rank households according earned income recalculate groups income adjustments single elderly man little earned income 50000 social security medicare benefits hes placed tier society adjustments help tier look welloff argue redoing ithe rankings themselvesi adjustments case man wouldnt assigned tier begin mathematically impossible lower quintile higher income higher case easiest householdsize adjustment reflects basic economic realities policy oldage benefits differ kind government transfersp pother subjective decisions abound instance place value public health care benefits enormous proportion government spending relnoopener hrefhttpswwwcbogovpublication58270 target_blankelderlya relnoopener hrefhttpswwwheritageorgsitesdefaultfilesinlineimagesbgwelfarespending2018allchartspage2825gif target_blankpoora dramatically change numbers authors value health benefits government pays medical services present conservative choice government underpays services forcing providers charge higher rates privately insured measure include programs administrative costs government paid 2000 someones medical care person received 2000 government benefits fair enoughp pon hand cant eat medicaid unlike food stamps spending function like cash folks programs doesnt necessarily improve wellbeing dollarfordollar fashion benefits lotteryinvaluable fall severely ill helpful avoid outofpocket costs routine care theyd skip peace mind judgment account issues 2016 report instance scott winship decided value medical benefits onequarter quotmarket valuequot determined census bureau discussion issue appendix 1 relnoopener hrefhttpswwwmanhattaninstituteorghtmlpovertyafterwelfarereformhtml target_blankhereap pcorrecting poverty rate fraught difficulties measuring trends time rate obviously consider government benefits properly account inflation standard living poverty line represent start onset war poverty roughly fifth americans officially considered poor track improvement relnoopener hrefhttpsfreebeaconcomissuesceawevewonlbjswaronpoverty target_blankthe war wona hardly poor mid1960s standards anymorep pbut standards living rise general sense means poor change relnoopener hrefhttpstwittercomdavebrady72status1363972784112635906langca target_blankcritics noteda aforementioned relnoopener hrefhttpswwwaeiorgresearchproductsreportannualreportonusconsumptionpoverty2017 target_blankmeyersullivan consumption measuresa suggest poverty rate 3 percent late 2010s quotanchoredquot official poverty rate 1980 result late2010s poverty thresholds 13000 18000 family exact number varying measures anchoring 2015 meyer sullivan reports instead raises poverty rate 12 percent thresholds 5000 supplemental poverty measure census bureaus attempt create poverty metric actually makes sense similarly classified relnoopener hrefhttpswwwcensusgovlibrarystories202201nationalpovertyinamericaawarenessmonthmeasuringpovertyhtml target_blankaround 10th americans poora recent yearsp pthere number ways fix official numbers gramm et als approach stellar job critiquing statistics heart economic debates providing thoughtprovoking alternativep pithe myth american inequality government biases policy debateibr phil gramm robert ekelund john earlybr rowman amp littlefield 255 pp 2995p pirobert verbruggen fellow manhattan instituteip pthe post relnofollow hrefhttpsfreebeaconcompolicyabetterreadontheeconomya better read economya appeared relnofollow hrefhttpsfreebeaconcomwashington free beaconap

63560f193aa0fa99976324f0

Podcast #200: Jonathan Kay on the State of Journalism, the Perils of Audience Capture, and the Art of Podcasting

iframe width100 srchttpsplaylistmegaphonefmeqltul3529324933 height200iframeimg altpodcast 200 jonathan kay on the state of journalism the perils of audience capture and the art of podcasting srchttpss3amazonawscomprodstaticcontentquillettecom202210200thepisodepngpfor our 200th episode emquilletteem founder claire lehmann interviews host jonathan kay about the evolution of his journalistic career before and after joining emquilletteemp

iframe width100 srchttpsplaylistmegaphonefmeqltul3529324933 height200iframeimg altpodcast 200 jonathan kay state journalism perils audience capture art podcasting srchttpss3amazonawscomprodstaticcontentquillettecom202210200thepisodepngpfor 200th episode emquilletteem founder claire lehmann interviews host jonathan kay evolution journalistic career joining emquilletteemp

635712937fd0f649659c8bf8

Adding the COVID-19 Vaccine to the Childhood Immunization Schedule Is a Mistake

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210vaccineshotcovid2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210vaccineshotcovid1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210vaccineshotcovid600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210vaccineshotcovid331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210vaccineshotcovid2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210vaccineshotcovid1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210vaccineshotcovid600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210vaccineshotcovid331x186jpg 331w img width1200 altgetting the vaccine srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpg height675 picture div pthe centers for disease control and prevention cdc are likely to add the covid19 vaccine to the immunization schedule for children and adolescents last week an advisory panel a hrefhttpswwwnbcnewscomhealthhealthnewskidscovidvaccinecdcgroupsaysaddvaccineroutineimmunizationschrcna53129voted unanimouslya to recommend the covid19 vaccines for all americans ages 6 months and older and the full agency is almost certain to sign off on this decisionp psuch a move would not emautomatically emmake the vaccines mandatory for children in theory cdc guidance is optional but in practice many municipalities will be inclined to require whatever the cdc recommends during the pandemic cities and states controlled by democratic political figures frequently rubberstamped federal health officials extremely cautious coronavirus recommendations relating to masks social distancing and lockdowns blue municipalities took their cues from their local health departments which in turn copied the cdcs guidance wholesale into formal policy when frustrated cautionweary constituents would ask their local officials about timelines for getting rid of mask mandates and reopening schools their answer was usually something like quotwhen the cdc says soquotp pthis means that adding the covid19 vaccine to the childhood immunization schedule will create a tremendous incentive for blue states to require it for public school children this would be a profound mistakep pin general the rationale for vaccine mandates is empublic emhealth public school children are required to get vaccinated for measles for instance in order to prevent the spread of measles to other more vulnerable individuals this same logic does not hold for the covid19 vaccines which have largely failed to prevent the spread of infection particularly for the covid19 variants the vaccines do a tremendous job of preventing elderly and atrisk people from suffering severe illness and dying but most children are spared the worst effects of covid19 anywayparticularly if they were already infected which is the case a hrefhttpswwwwebmdcomlungnews20221007eightysixpercentkidshavecovidantibodiesfrominfectionfor nearly nine out of every 10 kidsa according to the cdcp psome european countries have looked at the data and determined that there isnt enough net benefit to merit childhood vaccination denmark for instance is a hrefhttpsapnewscomarticlefactcheckdenmarkvaccinechildren439807145775no longer recommendinga covid19 vaccines for otherwise healthy young people under the age of 18 this is not because denmarks government was overtaken by antivaxers but rather because there are reasonable arguments both for and against the policy thus leaving the matter to individual families and their doctors is wise indeed even in the us less than a hrefhttpswwwcdcgovvaccinesacipmeetingsdownloadsslides202210192005covidoliver508pdf40 percenta of kids under the age of 11 have received the vaccine most parents have evidently decided that this course of action is not strictly necessary for their children and there is nothing wrong with thatp prequiring children to get the covid19 vaccine could on the other hand create several problems parents who are disinclined to give their children the covid19 vaccine might start to wonder whether the other vaccines on the childhood immunization schedule are similarly unnecessarywhich could have dire results for public health unvaccinated children might simply end up dropping out of school which would a hrefhttpsreasoncom20221024studentmathandreadingscoreshavedroppedsignificantlysince2019worsen the pandemicdriven crisis of learning lossa lowincome students and students of color will be hardest hit attempts by washington dc to require public school children to get jabbed were delayed after it became clear that a disproportionate number of unvaccinated black and brown young people would be banned from school a hrefhttpswamuorgstory221018messyrolloutdcstudentvaccineenforcementunder such a policyap pquotif mandates become the norm unvaccinated children will be displaced to virtual school home school or perhaps no school at allquot a hrefhttpswwwcommonsensenewspcovidvaccinesshouldntberoutinewritesa vinay prasad a health researcher and professor of epidemiology at the university of california san francisco quotthe harm to kids from substandard educationafter nearly two years of disruptionfar exceeds any gains from compliancequotp pa hrefhttpswwwtennesseancomstorynewspolitics20221021tennesseecdccovid19vaccinerecommendedimmunizationschedulegovbilllee69580326007some statesa have already signaled that they will not require the covid19 vaccine of school children even if the cdc schedules it given the reality of covid19most children already have some protection from it and getting vaccinated does not substantially prevent outbreaks of itthis is the right movep plet individual families talk to their doctors about vaccinating their children and make this decision on a casebycase basis the government does not have a legitimate rationale for butting inp pthe post a relnofollow hrefhttpsreasoncom20221024covid19vaccinationscheduleimmunizationchildhoodmistakeadding the covid19 vaccine to the childhood immunization schedule is a mistakea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap

div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210vaccineshotcovid2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210vaccineshotcovid1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210vaccineshotcovid600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210vaccineshotcovid331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202210vaccineshotcovid2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202210vaccineshotcovid1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202210vaccineshotcovid600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202210vaccineshotcovid331x186jpg 331w img width1200 altgetting vaccine srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202210vaccineshotcovid800x450jpg height675 picture div pthe centers disease control prevention cdc likely add covid19 vaccine immunization schedule children adolescents week advisory panel hrefhttpswwwnbcnewscomhealthhealthnewskidscovidvaccinecdcgroupsaysaddvaccineroutineimmunizationschrcna53129voted unanimouslya recommend covid19 vaccines americans ages 6 months older agency certain sign decisionp psuch notemautomaticallyemmake vaccines mandatory children theory cdc guidance optional practice municipalities inclined require cdc recommends pandemic cities states controlled democratic political figures frequently rubberstamped federal health officials extremely cautious coronavirus recommendations relating masks social distancing lockdowns blue municipalities took cues local health departments turn copied cdcs guidance wholesale formal policy frustrated cautionweary constituents ask local officials timelines getting rid mask mandates reopening schools answer usually like quotwhen cdc says soquotp pthis means adding covid19 vaccine childhood immunization schedule create tremendous incentive blue states require public school children profound mistakep pin general rationale vaccine mandates isempublicemhealth public school children required vaccinated measles instance order prevent spread measles vulnerable individuals logic hold covid19 vaccines largely failed prevent spread infection particularly covid19 variants vaccines tremendous job preventing elderly atrisk people suffering severe illness dying children spared worst effects covid19 anywayparticularly infected case hrefhttpswwwwebmdcomlungnews20221007eightysixpercentkidshavecovidantibodiesfrominfectionfor nearly 10 kidsa according cdcp psome european countries looked data determined isnt net benefit merit childhood vaccination denmark instance hrefhttpsapnewscomarticlefactcheckdenmarkvaccinechildren439807145775no longer recommendinga covid19 vaccines healthy young people age 18 denmarks government overtaken antivaxers reasonable arguments policy leaving matter individual families doctors wise hrefhttpswwwcdcgovvaccinesacipmeetingsdownloadsslides202210192005covidoliver508pdf40 percenta kids age 11 received vaccine parents evidently decided course action strictly necessary children wrong thatp prequiring children covid19 vaccine hand create problems parents disinclined children covid19 vaccine start wonder vaccines childhood immunization schedule similarly unnecessarywhich dire results public health unvaccinated children simply end dropping school hrefhttpsreasoncom20221024studentmathandreadingscoreshavedroppedsignificantlysince2019worsen pandemicdriven crisis learning lossa lowincome students students color hardest hit attempts washington dc require public school children jabbed delayed clear disproportionate number unvaccinated black brown young people banned school hrefhttpswamuorgstory221018messyrolloutdcstudentvaccineenforcementunder policyap pquotif mandates norm unvaccinated children displaced virtual school home school school allquot hrefhttpswwwcommonsensenewspcovidvaccinesshouldntberoutinewritesa vinay prasad health researcher professor epidemiology university california san francisco quotthe harm kids substandard educationafter nearly years disruptionfar exceeds gains compliancequotp pa hrefhttpswwwtennesseancomstorynewspolitics20221021tennesseecdccovid19vaccinerecommendedimmunizationschedulegovbilllee69580326007some statesa signaled require covid19 vaccine school children cdc schedules given reality covid19most children protection getting vaccinated substantially prevent outbreaks itthis right movep plet individual families talk doctors vaccinating children decision casebycase basis government legitimate rationale butting inp pthe post relnofollow hrefhttpsreasoncom20221024covid19vaccinationscheduleimmunizationchildhoodmistakeadding covid19 vaccine childhood immunization schedule mistakea appeared relnofollow hrefhttpsreasoncomreasoncomap

635713357fd0f649659c8c0d

Can Rishi Sunak possibly unite the Conservative Party?

pif a relnoopener hrefhttpswwwnewstatesmancomtagrishisunak target_blankrishi sunaka wants to survive for longer as prime minister than his predecessor he must now unite the conservative party that could prove difficult for the former chancellor he inherits a fractious party and the governments immediate task remains the divisive job of raising enough money to fill the fiscal gap left by a relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussas minibudget that means that in the coming weeks sunaks government will likely have to impose tax rises and spending cuts which will be deeply unpopular with tory mpsp pthere are positive signs for sunak tory backbenchers were bursting with enthusiasm after he gave his victory speech to the 1922 committee meeting this afternoon hes attracted support from both the right and the left of the party backers of a relnoopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsona such as the former chancellor nadhim zahawi and the european research group erg favourite suella braverman endorsed him before his victory was declared the brexiteers of the erg and the one nation grouping of more centrist mps have both promised to support himp pthat unity may not last long if his policies prove unpopular however truss faced a significant rebellion over plans not to raise benefits in line with inflation will sunak attempt the same if not then does he intend to keep the triple lock that means state pensions rise with average earnings inflation or by 2 per cent whichever is higher which department budgets will he cut will he scrap plans to raise defence spending to 3 per cent of gdp and risk the resignation of ben wallace the defence secretary the trigger for trusss resignation was a smart parliamentary move by labour that forced conservatives to vote on the return of fracking how will sunak navigate similar opposition ploys to divide the partyp ptory mps are now seasoned rebels the chaos of last week was yet another blow to party discipline and these tensions will only be exacerbated by the economic problems that remain the conservatives may now enjoy a boost in the polls albeit from a calamitous low point but once mortgages start to rise next year because of higher interest rates realterms pay falls further and the energy price guarantee expires in april discord may returnp pultimately tory mps desperately want to avoid an early general election given the state of the polls few mps will want to destabilise the government after the chaos of the past six months particularly if sunak appoints mps from across the party to the cabinet but that doesnt mean they wont cause problems for the new pm as the reality of renewed austerity becomes clearp pstrongem[see also a relnoopener hrefhttpswwwnewstatesmancompoliticsconservatives202210rishisunakwinsprimeministerpennymordauntfails target_blankrishi sunak to become prime minister after penny mordaunt withdrawsa]emstrongp

pif relnoopener hrefhttpswwwnewstatesmancomtagrishisunak target_blankrishi sunaka wants survive longer prime minister predecessor unite conservative party prove difficult chancellor inherits fractious party governments immediate task remains divisive job raising money fill fiscal gap left relnoopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussas minibudget means coming weeks sunaks government likely impose tax rises spending cuts deeply unpopular tory mpsp pthere positive signs sunak tory backbenchers bursting enthusiasm gave victory speech 1922 committee meeting afternoon hes attracted support right left party backers relnoopener hrefhttpswwwnewstatesmancomtagborisjohnson target_blankboris johnsona chancellor nadhim zahawi european research group erg favourite suella braverman endorsed victory declared brexiteers erg nation grouping centrist mps promised support himp pthat unity long policies prove unpopular truss faced significant rebellion plans raise benefits line inflation sunak attempt intend triple lock means state pensions rise average earnings inflation 2 cent whichever higher department budgets cut scrap plans raise defence spending 3 cent gdp risk resignation ben wallace defence secretary trigger trusss resignation smart parliamentary labour forced conservatives vote return fracking sunak navigate similar opposition ploys divide partyp ptory mps seasoned rebels chaos week blow party discipline tensions exacerbated economic problems remain conservatives enjoy boost polls albeit calamitous low point mortgages start rise year higher interest rates realterms pay falls energy price guarantee expires april discord returnp pultimately tory mps desperately want avoid early general election given state polls mps want destabilise government chaos past months particularly sunak appoints mps party cabinet doesnt mean wont cause problems new pm reality renewed austerity clearp pstrongem[see relnoopener hrefhttpswwwnewstatesmancompoliticsconservatives202210rishisunakwinsprimeministerpennymordauntfails target_blankrishi sunak prime minister penny mordaunt withdrawsa]emstrongp

6357135c7fd0f649659c8c11

Valuing the Deep State Part VI: Schedule F

img altvaluing the deep state part vi schedule f srchttpswwwamericanpurposecomcontentimages202210screenshot20221024at123229pmpngpemsixth article in a series on bureaucratic autonomy the first installment can be found a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea the second a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea the third a hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea the fourth a hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartivwhydelegationisnecessaryherea and the fifth a hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatevcontrollingtheadministrativestatehereaemppin their campaign against the deep state the republicans want not just to reform the civil servicea bureaucracy that genuinely needs reformbut to gut it from top to bottom if a republican is elected president in 2024 this will almost certainly happen even if the candidate is ron desantis or someone else other than donald trump hostility to the permanent civil service has become one of the unifying issues of the new populist republican partyppthis hostility was expressed by j d vance while campaigning for senate in ohio in the interview he suggested that if trump were to win the presidency again in 2024 he should fire every single midlevel bureaucrat every civil servant in the administrative state replace them with our people and when the courts stop you stand before the country and sayquoting andrew jacksonthe chief justice has made his ruling now let him enforce itppthe republicans already tried to do this on oct 21 2020 the trump administration issued a hrefhttpswwwgovinfogovcontentpkgfr20201026pdf202023780pdfexecutive order 13957a which created a new schedule f category for federal employees and ordered all agencies to move large numbers of their employees into this category ___steady_paywall___this order would in effect strip the newly recategorized employees of their civil service protections and leave them vulnerable to termination had donald trump won a second term he would have been able to dismiss large numbers of protected civil servants like dr anthony fauci or ambassador marie yovanovitch and replace them with his own political appointeesppone of the first acts of the incoming biden administration was to reverse schedule f like many actions taken by the outgoing administration the executive order was not planned particularly well and few executive agencies complied with it there is reason however to believe that the schedule f executive order was not simply a oneoff parting shot by an outgoing administration but the opening salvo in a larger conservative plan to weaken the career civil service to date 28 republicandominated states have moved their state bureaucracies to atwill employment the federallevel strategy would revolve around getting the supreme court to determine that meritbased hiring is emper seem unconstitutional and that the entire classification system that has existed since passage of the 1883 pendleton act needs to be replaced with what amounts to atwill hiring and firing the schedule f executive order was simply to be a stalking horse for a coming legal challenge that would force the supreme court now with a strong 63 conservative majority after the confirmation of amy coney barrett to address this issueppthe ability of congress to regulate appointments and removals seemed a matter of settled law through most of the 20supthsup century but in recent years has come under renewed attack by conservatives who echo many arguments raised in the 1930s against the new deal administrative state the most farreaching of their claims is that the delegation of authority to agencies by congress is emper se emunconstitutionalppthe constitutional argument is made on two separate grounds the first is built around the theory of the unified executive which sees the us constitution as giving the president rather than congress clear authority over the entire executive branch the current federal executive is anything but unified with an alphabet soup of agencies led by multimember boards and independent bodies like the federal reserve a second constitutional argument concerns separation of powers  many federal agencies in effect perform legislative judicial functions such as the decisions by administrative law judges who are not article iii jurists the apa tacitly acknowledges that federal agencies are performing quasilegislative acts when they issue new rules the ex ante procedural constraints it specifies merely limit their extentppthe right of presidents to appoint senior officers like cabinet secretaries with the advice and consent of the senate is uncontested and was affirmed in jurisprudence going all the way back to marbury v madison article ii section 2 states however that the congress may by law vest the appointment of such inferior officers as they think proper in the president alone in the courts of law or in the heads of departments it is on this ground that the pendleton act has been deemed constitutional over the decades the real issue would seem to be the location of the dividing line between inferior officers and their superiorspphowever as noted in my previous post presidential appointment and removal power were never considered equivalent and extensive removal power had been accepted since the decision of 1789 but in the postworld war ii period this power was limited by an increasing number of procedural rights to appeal by career civil servantsppthe case for enhanced removal power can be made on the grounds of government efficiency bureaucrats are not necessarily impartial public servants but individuals with their own policy preferences who might seek to obstruct policy changes resulting from an election that brings a new party to power in addition civil servants seek to protect their own selfinterest in ways that often do not correspond with public interest from the beginning of the progressive era civil servants organized themselves into public sector unions that sought not just to protect the merit system but also incumbency while the existing system permits forcause removals judicial protections have expanded so substantially under union pressure in the second half of the 20supthsup century that public managers find themselves unable to remove incompetent employees conservatives argued a pragmatic argument that disciplining the federal work force had become nearly impossible moreover the clear vesting of removal power in the head of the executive branch affords in theory greater accountability since voters can eject the president if they dont like his decisionsppas the j d vance quote cited earlier suggests however there is a second less legitimate argument in favor of increased political control which has to do with political patronage the meritbased civil service system was created to deal with problems of patronage and corruption that had plagued american public administration since the 1820s preventing the emergence of a highcapacity bureaucracy sufficient to meet the demands of a complex and rapidlychanging economy and society patronage power nonetheless remained a powerful demand on the part of politicians needless to say the conservative agenda of abolishing civil service protections under something like schedule f will vastly increase opportunities for patronage and the prospect that capable professional civil servants will be replaced by political appointees whose main qualification is their partisan loyalty we have already seen a preview of what this would look like in the trump presidency when competent civil servants were replaced by poorly qualified trump partisans the damage was limited then by the paucity of qualified loyalists as a hrefhttpswwwaxioscom20220722trumppresidencyscheduleffederalemployeesjonathan swann has documented in axiosa the republicans are spending their time out of office compiling lists of political appointees they would put into bureaucratic posts should they recover the presidency in 2024ppit is hard to describe the damage that will be done to american government if these plans are carried out while there is a good case to be made for great flexibility in the hiring and firing of federal officials the wholesale replacement of thousands of public servants with political cronies will take the nation back to the spoils system of the 19supthsup century republicans think that they will be undermining the deep state but they will simply be politicizing functions that should be carried out in an impartial way and will destroy the ethic of neutral public service that animates much of the government  when they lose power as they necessarily will the other party will simply get rid of their partisans and replace them with democratic loyalists in a way that undermines any continuity in government who will want a career in public service under these conditions  only political hacks opportunists and those who see openings for personal enrichment in the bureaucracyppthis is not to say that the current system under which the federal bureaucracy operates is a good one or that public sector reform isnt urgent and necessary but there are better ways of going about this other than the wholesale destruction of the career civil service which i will detail in my final postppemimage donald trump speaking at cpac 2011 in washington dc flickr a hrefhttpswwwflickrcomphotosgageskidmore31963023360inphotolistqgsrge2kn3vre2gabukk2gac7gu2gabyec2gac36a2gabyrjnfkifbnfm861nfmevdnww1xhngqcyfmk39twnddfaamjqzuanddmcanfmbhsnfksu1ngqqxinfmfocnddv5lmjq4d8nfmclumjq73mnwvyawmjqwfinddnymmjq4nxnz3n82mjqcvdngqdvfnddu7unz4p8cnz4kgpndd8fdnfkbpfngqzxtmk3rbomjq7pxmjqdmtnww7usnddajo26jzskx25dgyrulhj5edljv16akppeftlalzk7lal6vwllk6bcgage skidmoreaemp

img altvaluing deep state vi schedule f srchttpswwwamericanpurposecomcontentimages202210screenshot20221024at123229pmpngpemsixth article series bureaucratic autonomy installment found hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiherea second hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatepartiiherea hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartiiiastateofcourtsandpartiesherea fourth hrefhttpswwwamericanpurposecomarticlesvaluingthedeepstatepartivwhydelegationisnecessaryherea fifth hrefhttpswwwamericanpurposecomblogfukuyamavaluingthedeepstatevcontrollingtheadministrativestatehereaemppin campaign deep state republicans want reform civil servicea bureaucracy genuinely needs reformbut gut republican elected president 2024 certainly happen candidate ron desantis donald trump hostility permanent civil service unifying issues new populist republican partyppthis hostility expressed j d vance campaigning senate ohio interview suggested trump win presidency 2024 fire single midlevel bureaucrat civil servant administrative state replace people courts stop stand country sayquoting andrew jacksonthe chief justice ruling let enforce itppthe republicans tried oct 21 2020 trump administration issued hrefhttpswwwgovinfogovcontentpkgfr20201026pdf202023780pdfexecutive order 13957a created new schedule f category federal employees ordered agencies large numbers employees category ___steady_paywall___this order effect strip newly recategorized employees civil service protections leave vulnerable termination donald trump won second term able dismiss large numbers protected civil servants like dr anthony fauci ambassador marie yovanovitch replace political appointeesppone acts incoming biden administration reverse schedule f like actions taken outgoing administration executive order planned particularly executive agencies complied reason believe schedule f executive order simply oneoff parting shot outgoing administration opening salvo larger conservative plan weaken career civil service date 28 republicandominated states moved state bureaucracies atwill employment federallevel strategy revolve getting supreme court determine meritbased hiring emper unconstitutional entire classification system existed passage 1883 pendleton act needs replaced amounts atwill hiring firing schedule f executive order simply stalking horse coming legal challenge force supreme court strong 63 conservative majority confirmation amy coney barrett address issueppthe ability congress regulate appointments removals matter settled law 20supthsup century recent years come renewed attack conservatives echo arguments raised 1930s new deal administrative state farreaching claims delegation authority agencies congress emper se emunconstitutionalppthe constitutional argument separate grounds built theory unified executive sees constitution giving president congress clear authority entire executive branch current federal executive unified alphabet soup agencies led multimember boards independent bodies like federal reserve second constitutional argument concerns separation powers federal agencies effect perform legislative judicial functions decisions administrative law judges article iii jurists apa tacitly acknowledges federal agencies performing quasilegislative acts issue new rules ex ante procedural constraints specifies merely limit extentppthe right presidents appoint senior officers like cabinet secretaries advice consent senate uncontested affirmed jurisprudence going way marbury v madison article ii section 2 states congress law vest appointment inferior officers think proper president courts law heads departments ground pendleton act deemed constitutional decades real issue location dividing line inferior officers superiorspphowever noted previous post presidential appointment removal power considered equivalent extensive removal power accepted decision 1789 postworld war ii period power limited increasing number procedural rights appeal career civil servantsppthe case enhanced removal power grounds government efficiency bureaucrats necessarily impartial public servants individuals policy preferences seek obstruct policy changes resulting election brings new party power addition civil servants seek protect selfinterest ways correspond public interest beginning progressive era civil servants organized public sector unions sought protect merit system incumbency existing system permits forcause removals judicial protections expanded substantially union pressure second half 20supthsup century public managers find unable remove incompetent employees conservatives argued pragmatic argument disciplining federal work force nearly impossible clear vesting removal power head executive branch affords theory greater accountability voters eject president dont like decisionsppas j d vance quote cited earlier suggests second legitimate argument favor increased political control political patronage meritbased civil service system created deal problems patronage corruption plagued american public administration 1820s preventing emergence highcapacity bureaucracy sufficient meet demands complex rapidlychanging economy society patronage power nonetheless remained powerful demand politicians needless conservative agenda abolishing civil service protections like schedule f vastly increase opportunities patronage prospect capable professional civil servants replaced political appointees main qualification partisan loyalty seen preview look like trump presidency competent civil servants replaced poorly qualified trump partisans damage limited paucity qualified loyalists hrefhttpswwwaxioscom20220722trumppresidencyscheduleffederalemployeesjonathan swann documented axiosa republicans spending time office compiling lists political appointees bureaucratic posts recover presidency 2024ppit hard describe damage american government plans carried good case great flexibility hiring firing federal officials wholesale replacement thousands public servants political cronies nation spoils system 19supthsup century republicans think undermining deep state simply politicizing functions carried impartial way destroy ethic neutral public service animates government lose power necessarily party simply rid partisans replace democratic loyalists way undermines continuity government want career public service conditions political hacks opportunists openings personal enrichment bureaucracyppthis current system federal bureaucracy operates good public sector reform isnt urgent necessary better ways going wholesale destruction career civil service detail final postppemimage donald trump speaking cpac 2011 washington dc flickr hrefhttpswwwflickrcomphotosgageskidmore31963023360inphotolistqgsrge2kn3vre2gabukk2gac7gu2gabyec2gac36a2gabyrjnfkifbnfm861nfmevdnww1xhngqcyfmk39twnddfaamjqzuanddmcanfmbhsnfksu1ngqqxinfmfocnddv5lmjq4d8nfmclumjq73mnwvyawmjqwfinddnymmjq4nxnz3n82mjqcvdngqdvfnddu7unz4p8cnz4kgpndd8fdnfkbpfngqzxtmk3rbomjq7pxmjqdmtnww7usnddajo26jzskx25dgyrulhj5edljv16akppeftlalzk7lal6vwllk6bcgage skidmoreaemp

6357136c7fd0f649659c8c15

Russia sentence of the day

blockquotepsome local girls married one vdv [part of the military] guy after another because theyre dying quickly enough that you can get several compensations in a few monthspblockquote pthat is a relnoopener hrefhttpswwwchinatalkmediapkamilonnukesandcivilwarinrussiar9yi6utm_mediumandroid target_blankkamil galeev interview with jordan schneidera excellent and interesting throughout  the close is with a tatar folk songp pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210russiasentenceofthedayhtmlrussia sentence of the daya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

blockquotepsome local girls married vdv [part military] guy theyre dying quickly compensations monthspblockquote pthat relnoopener hrefhttpswwwchinatalkmediapkamilonnukesandcivilwarinrussiar9yi6utm_mediumandroid target_blankkamil galeev interview jordan schneidera excellent interesting close tatar folk songp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202210russiasentenceofthedayhtmlrussia sentence daya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap

635713e57fd0f649659c8c25

Incapacitated: How a lack of state capacity doomed pandemic results

div classwpcontainer1 wpblockbuttons div classwpblockbuttona classwpblockbutton__link hrefhttpswwwniskanencenterorgwpcontentuploads202210incapacitatedpdfdownload the full paperadiv div pthe covid19 pandemic is not over during august 2022 more than 18 months since the first us case was reported on jan 20 2020 a hrefhttpsourworldindataorgcoviddeathsnearly 500 americans died every daya from the disease while the number of people hospitalized on a given day exceeded a hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerfacetnonemetrichospitalpatientsinterval7dayrollingaveragerelativetopopulationfalsecolorbytestpositivityfalsecountrydeuusa30000a worldwide the confirmed daily death count remained in the thousandsp pdespite these grim statistics it is fair to say that barring the emergence of some new and deadly variant the crisis stage of the pandemic has passed here in the united states most restrictions relating to closings mask wearing and social distancing have been lifted and the emergency fiscal responses have played out globally the situation is similar although china an outlier continues to persevere with its zero covid policy of rolling lockdowns here and in most places however we have transitioned from an extraordinary public health emergency to a grim new normal in which a viral killer considerably more lethal than the flu has now been added to lifes ongoing risks p plooking back at the us pandemic response across two administrations and three congresses we see a record of crisis management that includes some significant accomplishments and breathtaking successes and a long dismal string of missteps and failures in this essay i try to identify the fundamental flaws in american state capacity that led to those missteps and failures and that could lead to much greater death and suffering in future pandemics if we fail to learn from our mistakesp plets start with the good news at the top of the list is the development and mass production of effective vaccines in well under a year a feat that most experts at the outset of the pandemic would have considered impossible us companies pfizer and moderna were at the forefront of that effort with their pathbreaking mrna vaccines and the us governments operation warp speed played a vital role in accelerating drug testing and approval and coordinating the supply chains upon which the rapid scaleup of production depended its been estimated that a hrefhttpswwwvoxcom22894978covid19vaccinelivessaveddeathsavoidedomicronchartvaccines saved over 1 million american livesa during 2021 alone globally the estimated number of lives saved by vaccines during their first year stands at a hrefhttpswwweconomistcomgraphicdetail20220707covid19vaccinessavedanestimated20mlivesduringtheirfirstyear20 millionap pmeanwhile notwithstanding all the different ways public health authorities botched things they did succeed in leading the country through a mass mobilization whose intensity and duration have no counterpart in the american experience outside of wartime this time instead of being mobilized to produce war materiel and fight battles americans were mobilized to avoid infecting each other through staying at home when they could and when they did go out through masking and keeping their distance from others although this allofsociety effort was badly misdirected at times and over time was considerably weakened by growing resistance backlash and simple exhaustion nonetheless it stands as one of the most astonishing feats of concerted mass behavior modification in history the effort was greatly aided by the advanced digitization of economic life which allowed many people to work from home schooling albeit in diminished form to continue on a remote basis and online delivery services to substitute for inperson shopping and dining since studies now confirm that masking and social distancing were effective in reducing infection rates by approximately a hrefhttpswwwbmjcomcontent375bmj202106830250 percent and 25 percenta respectively this mobilization campaign for all its flaws and excesses and loopholes saved large numbers of lives by preventing health care systems from being overrun and keeping people safe until vaccines and better treatments were developed p pfinally in the face of the massive economic shock caused primarily by fear of the virus and then exacerbated by public health restrictions congress overcame a toxically polarized political climate to shovel out trillions of dollars in emergency relief spending again there is much to criticize in the details of those spending packages and in how the emergency programs were implemented in particular the inflation we are now experiencing was doubtless made worse by all that largesse yet when we look at how well household incomes held up during the crisis and at how rapidly employment has bounced back the fairest conclusion is that congress fiscal activism prevented a terrible situation from getting much much much worsep phaving acknowledged the silver linings its time to face the black cloud the overall us pandemic response must be judged a shocking and dispiriting failure in may 2022 16 months into the pandemic the us confirmed death toll passed a hrefhttpswwwnytimescom20220519ususcoviddeathshtml1 milliona and sixfigure annual death tolls now look likely going forward for the foreseeable future the us cumulative covid mortality rate as of aug 31 2022 a hrefhttpsourworldindataorgcoviddeaths310 deaths per 100000 peoplea was the highest of any advanced democracy by way of comparison the cumulative mortality rate in the united kingdom was 305 per 100000 in italy 296 in france 229 in sweden 189 in germany 177 in norway 74 and in japan 32p h2stronganatomy of a megadeathstrongh2 pmany millions of words have already been written about americas fumbling response to the pandemic ive read lots of them and ive a hrefhttpswwwniskanencenterorglessonsfromthepandemicavideointerviewseriesintervieweda a number of experts for indepth discussions of various aspects of the story no doubt more details will come to light over time as official inquires are conducted and definitive histories are written but the broad outlines of what went wrong and what occasionally went right are now abundantly clearp pthere are two major reasons why covid19 was so much deadlier in the united states than in most peer countries first from before the first confirmed us infection until it was too late to matter ie until the emergence of the highly transmissible omicron variant american authorities proved incapable of standing up and executing testing at sufficient scale that is to enable effective public health screening along with followup contact tracing and coordination and support for isolation of the sick and exposed accordingly it was never possible to identify and locate outbreaks early enough to drive down transmission rates and suppress the virus as a result until vaccines became available authorities were forced to rely on the blunderbuss tool of indiscriminate closings and social distancing mandates to keep infections and deaths down the failures with testing tracing and supported isolation account for the vast majority of the nearly 350000 confirmed deaths in 2020a hrefhttpswwwniskanencenterorgincapacitatedhowalackofstatecapacitydoomedpandemicresultsendnote1sup[1]supa by comparison wellmanaged countries kept fatalities in check during the prevaccine prevariant phase of the pandemic australia and south korea saw just over 900 confirmed deaths japan fewer than 3500 taiwan registered only seven confirmed covid deaths that yearp pthe second reason is that despite developing the two most effective vaccines and getting a big jump on most of the world in vaccine distribution the united states ended up achieving considerably lower vaccination rates than other advanced countries as of aug 31 2022 a hrefhttpsourworldindataorgcovidvaccinations68 percent of the us populationa was fully vaccinated compared to 75 percent in the united kingdom 76 percent in germany 79 percent in france 82 percent in japan and 84 percent in australia the united states has also lagged badly in booster shots important for controlling the severity of illness for the more transmissible delta and omicron variants in the us as of aug 24 2022 a hrefhttpsourworldindataorggraphercovidvaccineboosterdosespercapitacountryusaausfradeujpn39 booster doses have been administered per 100 peoplea compared to 55 in australia 60 in the united kingdom 63 in france 70 in germany and 85 in japan p phow do we apportion blame for these signal failures i nominate three leading candidates 1 failures of political leadership 2 lack of relevant a hrefhttpswwwniskanencenterorgtruststatecapacityandtheepidemiologicalmysteryofcovidstate capacitya and 3 problems in the underlying political culture and culture more broadly that make state capacity hard to amass and wield all three bear some measure of responsibility but the purpose of this essay is to make the case for the importance of 2 as i will discuss the lack of relevant state capacity that is the absence of appropriate governing structures organization capabilities and focus played a critical role in undermining the us pandemic response and the task of building up that missing capacity should be our top priority in seeking to prevent a similar catastrophe in the futurep pbut first lets look at the other candidates as to political leadership the obvious question arises was this all trumps fault to be sure it was singularly unfortunate that the gravest public health crisis in a century occurred during the presidency of the most spectacularly unfit individual to ever hold the office by may 2020 he had essentially abdicated any federal role in testing tracing and isolation and then spoke out repeatedly against widespread testing because it made the covid case numbers look bad he refused to wear masks encouraged backlash against public health restrictions and peddled quack cures its hard to even imagine a more irresponsible leaderp pdespite all this its by no means clear that things would have gone much better had hillary clinton been president instead the centers for disease control and preventions disastrous misfires on testing would likely have occurred all the same and the political polarization that sowed the seeds of resistance and backlash against restrictions preceded the 2016 election and most assuredly would not have been pacified by a clinton victory and in spite of all trumps personal clownishness his administration did conceive and execute operation warp speed we have no reason to assume and some reason to doubt that a clinton administration would have done as good a job on vaccine developmenta hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[2]supa p pmeanwhile the return to normalcy under joe biden hasnt sufficed to turn things around as ill discuss later the biden administrations record on all things pandemicrelated has been to put it kindly less than stellar in short the problems that led to americas failed pandemic response go deeper than trump they preceded him and have persisted after his departurep pamericas highly polarized political culture meanwhile clearly played a role in driving up fatalities during the pandemic organized backlash against public health mandates and restrictions doubtless reduced compliance and thereby increased chances for the virus to spread for a variety of reasons though it is difficult to connect variation in compliance with nonpharmaceutical interventions npis with variations in infections hospitalizations and deaths with vaccinations meanwhile impacts are easier to trace and the variation in vaccination rates on either side of the partisan divide is stark according to a a hrefhttpsmorningconsultcomcovid19vaccinedashboardjuly 2022 surveya 83 percent of democrats reported that they were already vaccinated compared to 63 percent of republicans out of the 17 percent of democrats not yet vaccinated just over half said they were unwilling to get the shots meanwhile of the 38 percent of unvaccinated republicans more than threequarters said they were unwilling to get vaccinated the effect of the relatively low us vaccination rate on fatalities has been significant a study by the brown university school of public health estimates that a hrefhttpsglobalepidemicsorgvaccinationsover 300000a of the millionplus us covid deaths could have been avoided with vaccinationsp pyet if the us pandemic response had been run according to global best practices from the outset there would have been much more limited scope for political polarization to drive events with appropriate testing and tracing programs in place the initial outbreaks of the virus could have been isolated and suppressed and there would have been no need for mass restrictions of indefinite duration and no backlash against them by the time vaccines were available the contrast between a largely diseasefree united states and largescale suffering elsewhere in the world would likely have bolstered trust in public health authorities and reduced resistance to vaccinationp pmy conclusion then is that governance failures the inability of american public health authorities to do the job that they were widely considered to be the best in the world at doing are the primary reason for the countrys poor record in dealing with the pandemic the overwhelming majority of the nearly 350000 fatalities during 2020 ie before vaccines could have been avoided and that accomplishment could have saved many of the 300000plus avoidable deaths caused by vaccine resistancep h2stronga failure of imaginationstrongh2 pthe specific nature of the breakdown in state capacity at fault is made clear by the battle lines of polarization over the pandemic the country split with increasing bitterness and rancor over mandates and restrictions in the early days the poles of the split were reversed people on the right talked up strict limits on international travel while people on the left minimized the threat and denounced travel restrictions as veiled racism relatively quickly though the opposing sides switched places and then dug in on the right the severity of the virus was minimized and closures social distancing requirements and mask mandates were denounced as tyrannical overkill the left meanwhile took the virus seriously and taking it seriously meant embracing restrictions and maintaining them indefinitely even after vaccines were developed both sides stuck to their positions people on the right tended to discount the vaccines safety and efficacy while people on the left tended to minimize the relevance of vaccine availability to the case for maintaining restrictionsa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[3]supap pin other words americans split over whether to simply surrender to the virus and let it run rampant or to hide from it indefinitely what never emerged as a widely embraced option in the prevaccine phase of the pandemic because our public health authorities were never able to provide it was a third alternative not to surrender not to hide forever but to defeat the virus the critical absence of state capacity on display during the pandemic was the inability to develop manage and communicate a strategy for victory to use testing tracing and isolation to suppress the virus altogether pending successful suppression to develop and deploy protective technologies highquality masks improved ventilation and air filtration a hrefhttpswwwnaturecomarticless4159802208462zfarultraviolet lighta to allow people to function safely in public and to expedite the development of effective vaccines and treatments so that we could ultimately return to the status quo ante virus the third component of that strategy was partially implemented with tens of millions of lives saved around the world as a result the other two elements however never got off the groundp pthe failure to formulate and execute a strategy for victory was at bottom a failure of imagination a failure to shake off a emcompliance mindsetem wedded to following established procedures and adopt instead a emwarfighting mindsetem dedicated to achieving desired results all government agencies rely on established procedures lacking the clear market feedback that private businesses receive on a daily basis the public sector is forced to lean heavily on fidelity to process in ensuring accountability by officials hence the notorious vulnerability that gives bureaucracy its bad name a pronounced tendency to prioritize looking backward at the rulebook over looking forward toward advancing the agencys missionp pbut in a crisis an acute threat to public safety or order the feedback problem dissipates and both the objective of government action and the metrics for judging its efficacy become gravely clear the essential question at such junctures is whether the government can recognize the change in circumstances and adapt accordingly we see this most clearly in military affairs and the stark differences between a peacetime army and a successful wartime army in peacetime leaders frequently rise on the basis of skill at playing various political games ingratiating themselves with superiors amassing larger budgets etc but when war comes the army risks annihilation unless it can devise a winning strategy and find leaders who can execute that strategyp pthe outbreak of an infectious disease is akin to the outbreak of a war it is an invasion by a deadly foreign adversary that threatens life and public order on a mass scale yet the decline until recently of infectious disease as a major threat to the general population in rich countries had lulled public health authorities into complacency the development of antibiotics and vaccines once promised to end the ageold scourge of infectious disease a promise upheld most spectacularly with the global eradication of smallpox by 1980 and as communicable disease receded as a clear and present danger public health authorities steadily shifted their focus to chronic health problems cancer heart disease obesity drug abuse and the like p psince the victory over smallpox however our ancient adversary has been staging a comeback thanks to the rise of antibiotic resistance the ongoing human encroachment onto habitats of diseasecarrying wildlife the spread of factory farming and livestock as disease vectors and the intensification of domestic and global travel first came hivaids but outside africa its concentration among gay men tragically muted its warning signal the 21st century has seen outbreaks of bird flu swine flu sars mers zika and ebola but none made sufficient inroads in richcountry populations to significantly alter perceptions of the threat level our luck ran out in late 2019 precisely a century after the end of our last global pandemicp pin taiwan a bad experience with sars helped to banish complacency and the poor handling of mers in south korea had a similar effect there but in the united states none of the nearmisses earlier this century sufficed to impress on public health authorities or political leaders that the country was not adequately prepared for a direct hit and when that direct hit came it proved impossible for the now deeply entrenched organizational cultures in the public health system to turn on a dime and switch to war mode p h2strongpeacetime agencies wartime challengesstrongh2 pthe cdc entered the pandemic with the reputation as the worlds leading diseasefighting agency and in many respects the reputation was deserved it houses worldclass expertise and conducts vitally important research but whatever the cdc had been in the past it originated from a world war ii military program to control malaria in the southern united states and it spearheaded hugely successful smallpox eradication efforts in africa and later globally it was no longer oriented toward directing action in the field much less largescale crisis managementa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[4]supa the cdc was a peacetime agency focused on conducting academic research rather than preparing for invasion as former food and drug administration commissioner scott gottlieb a hrefhttpstwittercomscottgottliebmdstatus1426890092036202499commenteda cdc is a retrospective agency its not in the business of gathering realtime info that requires analytical work and providing partial answers  p pthe cdc notoriously produced a test kit that didnt work but its whole approach to testing was fatally flawed there was never any chance of standing up adequate testing capability without the participation of the big private labs only they were capable of producing and administering tests at sufficient scale the cdc however had no history of working with private labs it preferred to work alone or in conjunction with the small network of public labs during the zika scare of 201516 it became painfully apparent that this approach was insufficient to handle a us outbreak the cdc fell behind in supplying tests then developed a new test that didnt work as well as the old one and then failed to supply a test to commercial labs to ramp up supplya hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[5]supa as a result there was never adequate testing to track progress of the disease and zika a mosquitoborne illness spreads far more slowly than the airborne novel coronavirus yet despite widespread criticism of the cdcs handling of zika nothing changed the cdc jealously guarded its institutional control over testing rather than adapting in the face of failure p pbeyond its problems with testing which made it impossible to develop actionable intelligence about the location of the enemy the cdc also proved incapable of assimilating incoming intelligence about the nature of the virus and applying it successfully to response efforts its backwardlooking academic culture focused on generating publishable research results was inimical to the kind of intellectual nimbleness and flexibility needed to operate in the fog of war the most spectacular failure in this regard was the cdcs dogged refusal to recognize that the virus spread through aerosolized airborne transmission as well as through small saliva droplets from very early on in the pandemic the pattern of infection in superspreader events for example aboard the a hrefhttpswwwnytimescom20200730healthdiamondprincesscoronavirusaerosolhtmldiamond princessa cruise ship and at a a hrefhttpseditioncnncom20200513uscoronaviruswashingtonchoiroutbreaktrndindexhtmlchoir practicea in washington state suggested strongly that airborne transmission was likely but it wasnt until a hrefhttpswwwusatodaycomstorynewshealth20201005covidcdcupdatesguidelinesincludeairbornetransmission3627932001october 2020a many months into the crisis that the cdc made a grudging admission that airborne transmission was possible while still discounting its importance only in a hrefhttpswwwnytimescom20210507healthcoronavirusairbornethreathtmlmay 2021a did the cdc finally issue guidance that properly acknowledged the threat of airborne transmissionp pa whole domino effect of missteps ensued from this intelligence failure the overemphasis on saliva droplets led to a misplaced fear of surface transmission and enormous amounts of wasted effort on a hrefhttpswwwtheatlanticcomideasarchive202007scourgehygienetheater614599hygiene theatera parks were closed and outdoor activities restricted when spending time outside was the safest thing you could do in indoor spaces maintaining 6 feet of distance between people became holy writ while pressing issues of ventilation and air filtration were badly underemphasized p panother major intelligence blunder involving not just the cdc but other elements of the national and global public health establishment as well concerned the use of face masks early on public health authorities discouraged the use of masks by the general public in part because of a misreading of evidence concerning their utility in part as an underhanded effort to reserve dwindling supplies for health care workers this flipflopping at the outset of the crisis gave clear evidence that the experts in charge werent just fallible they were untrustworthy helping to set the stage for resistance and backlash to comep pthe other federal agency with a leading role in managing the pandemic was the food and drug administration which is in charge of approving new diagnostics vaccines and treatments like the cdc the fda came to the pandemic with a deeply entrenched institutional culture that was inimical to effective crisis management dating all the way back to the a hrefhttpspubmedncbinlmnihgov21507989thalidomide disastera of the late 1950s the fda has prioritized keeping unsafe drugs off the market over expediting the approval of new safe and effective drugs the politics of this asymmetry are understandable a drug approval that backfired would create known victims causing a public firestorm and grievously compromising the fdas reputation while the identities of the people who might die as a result of delays in the approval of a new drug would generally never be known the economist alex tabarrok refers to these hidden victims of delay as the fdas a hrefhttpsmarginalrevolutioncommarginalrevolution202101theinvisiblegraveyardisinvisiblenomorehtmlinvisible graveyarda but in an outbreak of communicable disease the victims are visible and they pile up rapidlyp pyet the fda carried its peacetime institutional caution into the pandemic early on it contributed to the testing debacle by improperly asserting jurisdiction over the approval of labdeveloped tests before backing off to be fair participation in operation warp speed did rouse the agency from its usual torpor at least temporarily as the fda showed unaccustomed flexibility in expediting clinical trials for the new vaccines but old habits quickly reasserted themselves after pfizer submitted its emergency use authorization for its mrna vaccine on nov 20 2020 the fda waited until dec 10 to schedule a meeting to consider the application during which time it basically closed for four days during the thanksgiving holiday nearly 40000 americans died during this interim the fda never approved the astrazeneca vaccine despite its successful use around the world also it along with the cdc imposed a misguided temporary pause on use of the johnson amp johnson vaccine dealing a serious blow to public confidence in the drug and it dragged its feet on approval of athome covid test kits which were readily available in europe months before here p pas my colleague a hrefhttpswwwslowboringcompflexiblehealthmatthew yglesiasa noted on his slow boring blog public health authorities asked and expected the american public to show incredible flexibility upending their lives for the common good working from home masking and distancing supervising kids remote education missing weddings and funerals yet what they asked of us they proved unable to do themselves faced with an unprecedented crisis in which rapid action on the basis of incomplete information was the only path to victory again and again they chose to stick with established rules and procedures over the adaptation and improvisation that were called for weve changed a lot to cope with the pandemic yglesias wrote but the institutions charged with protecting us have stayed rigidp pthat rigidity has proved depressingly durable as revealed by the recent course of the global monkeypox outbreak the nations public health authorities remain stuck in bureaucratized amber the first us monkeypox infection was confirmed on may 19 2022 by aug 22 the a hrefhttpswwwcdcgovpoxvirusmonkeypoxresponse2022worldmaphtmlus had over 15000 confirmed casesa out of a world total of just under 43000 the virus was able to spread so rapidly because once again we failed to do adequate testing and contact tracing the cdc reprised its role as bottleneck a hrefhttpswwwstatnewscom20220527monkeypoxtestcapacitycdcconsidersexpandinginsisting at the beginninga that all tests be run through its network of public labs and also be sent to the agency for confirmation furthermore a hrefhttpswwwmsncomenusnewsusafterrepeatingearlycovidmistakesusnowhastheworldsbiggestmonkeypoxoutbreakaraa10im7hlibbnb7kzdoctors were requireda to get state health department authorization for every test slowing things down further the cdc did not expand testing to include commercial labs until a hrefhttpswwwhhsgovaboutnews20220622hhsexpandingmonkeypoxtestingcapacityfivecommerciallaboratorycompanieshtmllate junea by the end of june a hrefhttpswwwnytimescom20220730opinionmonkeypoxpublichealthfailurehtmlsmidtwnytopinionsmtypcuronly around 2000 testsa had been completedp pfortunately this time we already have vaccines and treatments created for the similar but far deadlier smallpox virus but although we have known for years that the disease was endemic in africa and could jump to our shores on the next plane flight a hrefhttpswwwnytimescom20220801nyregionmonkeypoxvaccinejynneosushtmlwe allowed our stockpilea of the new stateoftheart vaccine to dwindle to 2400 doses enough to vaccinate 1200 people millions of doses were warehoused in unmixed freezedried form in the netherlands and another 14 million doses were filled and ready for shipment after the first us case the biden administration ordered 372000 vaccine doses to be shipped to the united states the other millionplus doses couldnt be shipped yet because the fda had not gotten around to inspecting the drug makers new fillfinish facility that inspection did not occur until the end of june more than a month after the first case and thus vaccine distribution fell badly behind demand when asked about the delays in getting doses to the us one government spokesperson said the delays were less severe if counted in a hrefhttpswwwnytimescom20220725nyregionnycmonkeypoxvaccinedosesdenmarkhtmlbusiness daysa the administration has ordered millions of more doses to be made from the bulk supply but that will take months p pinadequate testing cdc controlfreakery leisurely fda approval schedules sound familiar and the dj vu moments keep coming a hrefhttpswwwtheatlanticcomnewslettersarchive202207usmessagingonmonkeypoxisdeeplyflawed670573messaginga to the public has been a mess although monkeypox cases outside africa have been heavily concentrated among gay men the cdc and other health authorities have buried that fact in their public pronouncements for fear of creating stigma meanwhile improvisations that could make the best of a bad situation have been officially discouraged rather than promoted despite strong evidence that a single dose of monkeypox vaccine confers good protection a hrefhttpswwwscienceorgcontentarticletheresshortagemonkeypoxvaccinecouldonedoseinsteadtwosufficethe cdc and fda have warned againsta adopting a first doses first vaccination strategy to stretch limited supplies of the drug fortunately the new york city health department has a hrefhttpswwwstatnewscom20220715nyconedosemonkeypoxstrategycdcfdawarningsagainstignored the federal warningsa and proceeded to maximize the availability of first dosesp pone glimmer of hopeful news on aug 17 2022 cdc director a hrefhttpswwwnytimescom20220817uspoliticscdcrochellewalenskycovidhtmlrochelle walenskya announced plans to reorganize the agency after publicly admitting to major failures during the pandemic to be frank we are responsible for some pretty dramatic pretty public mistakes from testing to data to communications walensky said her reform plans focus on shifting the cdcs focus away from academic research and toward more rapidly sharing data and translating research into practically useful intelligence and guidance p palthough the overall outlines of the reorganization initiative look sound there are limits to what purely internal reforms can accomplish as walensky has noted some of her plans will a hrefhttpswwwstatnewscom20220817cdcambitiousoverhaulcovidmisstepsdepend on congressional actiona including requiring state and local authorities to share data with the cdc and providing additional funding beyond that it is doubtful that the deep cultural change that is needed can be accomplished without a more thoroughgoing shakeup of the agency and resetting of its priorities by congressp h2strongthe path partially takenstrongh2 pthe one area where the us pandemic response not only met but exceeded expectations was in vaccine development thanks in particular to the trump administrations operation warp speed initiative ows a partnership between the department of health and human services and the department of defense sought to accelerate the development and distribution of vaccines through a variety of mechanisms it selected six vaccine candidates on three different platforms ie different types of vaccines this diversified portfolio maximized chances for finding a winner early it entered advance purchase contracts with the drug makers agreeing to purchase large volumes at attractive prices if a firm came through with an approved drug it provided billions in financial support to expedite vaccine development clinical trials and rampup of manufacturing capacity pfizer did not accept funds under ows but its partner biontech received hundreds of millions of dollars of support from the german government it allowed companies to run different phases of clinical trials concurrently to accelerate the approval process it worked with participants to expand manufacturing capacity even before approval so distribution could begin as soon as possible and it worked with producers and suppliers to identify and resolve supply chain problems so that competing firms did not work at crosspurposes in ramping up productionp pthe result was a spectacular and historic success one that deserves to be mentioned in the same breath with the manhattan project the berlin airlift and project apollo it was a return to glory of what alex tabarrok calls the american model of innovation getting the visible hand and the invisible hand to work together by combining the spending power of the federal government with the innovativeness and the speed of americas incredibly sophisticated private companiesa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[6]supa p poperation warp speed succeeded because it shifted innovation policy from peacetime to wartime mode under normal peacetime conditions the government has a general interest in encouraging innovation but is unable to predict where the most promising avenues for commercially viable technological progress might lie accordingly rather than trying to aim private efforts at particular projects the government offers a general incentive in the form of patents if you come up with something new nonobvious and useful and you find a market for it you can enjoy temporary market exclusivity to ensure you recoup your investment and earn a healthy return but under the wartime conditions of the pandemic the situation is very different the government now knows exactly what kind of technological progress is urgently needed diagnostics vaccines and treatments for a particular pathogen in these situations upfront rampd support and advance purchase agreements that guarantee a healthy return for development of the desired product offer the focused targeted incentives that are necessary there is no need to defer to private companies to figure out which innovations can be commercialized because here the government is the purchaser and can tell the companies what it wants and the government needs to be the relevant purchaser because we dont want access to vaccines to be contingent upon ability to payp poperation warp speeds one tragic flaw was that its model was not applied much more widely most obviously after the initial stumble on testing an ows for test kits not only the more sensitive pcr tests but also the cheaper faster antigen tests could have blanketed the country in ubiquitous testing capacity even after the pandemic was in full swing it would have been possible to set up testing and isolation protocols to allow essential businesses and activities to continue operating safely the nfl did it completing a full season of a contact sport without resort to a selfisolated bubble a number of universities used regular testing to stay open with ubiquitous cheap tests available these outlier success stories could have been the normp pthe ows model could also have been extended to encompass personal protective equipment here again we could have had massive quantities of face masks not just surgical masks but n95 masks that afford much better protection we could have gone further and developed nextgeneration ppe masks or headgear that are easy to wear comfortable for longer use and safe p peven with vaccines operation warp speed remained partially stuck in peacetime mode after being incentivized appropriately with advance purchase agreements and government research support drug makers were also allowed to retain patent rights in the case of moderna the national institutes of health actually held patents on key elements of the vaccine for the other firms the government could have bought out their patent rights or asserted licensing authority under laws a hrefhttpscrsreportscongressgovproductpdflsblsb10422marchin rights under the bayhdole act or section 1498a that allow the government to use intellectual property with just compensation in this way the government could have dramatically accelerated global vaccine distribution by directing one or more ows participants to share technology and manufacturing knowhow with capable producers in lessdeveloped countriesp pthe only chance to truly suppress this virus and keep it from becoming endemic was to achieve high rates of highly effective vaccination around the world as of late august 2022 the global vaccination rate stands at only a hrefhttpsourworldindataorgcovidvaccinations63 percenta in the a hrefhttpswwwtheguardiancomglobaldevelopment2022jul21covidvaccinefigureslaybareglobalinequalityasglobaltargetmissedworlds poorest countriesa less than 20 percent of people have been fully vaccinated and the vaccines are no longer highly effective new variants of the virus emerged that can transmit fairly easily notwithstanding vaccination although inoculation continues to offer strong protection against severe illness and death the bottom line the horses are now long out of the stable and the novel coronavirus will be with us for many years to comep pmeanwhile operation warp speed was discontinued by the biden administration and no equivalent effort to fund and expedite nextgeneration vaccines was instituted we continue to use vaccines that were designed for the original novel coronavirus on the bright side pfizer and moderna have both developed bivalent boosters that target both the original virus and the currently dominant ba5 omicron subvariant actually they were designed for the nowsuperseded a hrefhttpswwwslowboringcompweregettinganomicronoptimizedba1 subvarianta and are substantially less effective against ba5 the fda granted an emergency use authorization for both boosters on aug 31 2022 but other a hrefhttpswwwslowboringcompwecouldhaveuniversalcovidvaccinesmore promising vaccinesa remain in development including nasal vaccines that more effectively block transmission as well as socalled panvariant vaccines alas on current schedules these new vaccines are unlikely to be available before 2024 if operation warp speed or its equivalent were still in place we could have had these important weapons in our antipandemic arsenal available much soonerp h2strongplease look up strongh2 pone might have expected that the failures of the pandemic response would produce a sufficient shock to the system to catalyze major change and as mentioned above the cdc to its credit has conducted an internal review and is planning some important reforms but the sweeping organizational changes and significant funding increases needed to create worldclass pandemicfighting state capacity cannot occur without new legislation and thus far at least there is virtually no appetite in either congress or the biden administration for taking on this challengep pthe only pandemicrelated reform legislation to make any headway to date is the prevent pandemics act cosponsored by senators patty murray and richard burr this rather modest bill does a few potentially useful things including establishing a permanent white house office for pandemic preparedness authorizing a national task force to conduct an extensive postmortem on the countrys pandemic response and mandating better information sharing between the cdc and state and local health authorities but it is a far cry from the comprehensive changes that are called for and its prospects for passage are far from bright the bill was advanced out of the senate health education labor and pensions committee back on march 22 but has not yet found its way to the senate floor meanwhile there is as of yet no companion bill in the housep pthe biden administration for its part in september 2021  proposed a 10year 65 billion a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20210903factsheetbidenadministrationtotransformcapabilitiesforpandemicpreparednessspending packagea to upgrade the countrys pandemic preparedness the proposal based on the recommendations of a a hrefhttpsbiodefensecommissionorgreportstheapolloprogramforbiodefensewinningtheraceagainstbiologicalthreatsbipartisan commission on biodefensea cochaired by joe lieberman and tom ridge called for creating vaccines for a variety of pathogens using genomic sequencing and clinical data to establish an early warning system for outbreaks developing nextgeneration ppe replenishing key stockpiles and more what the proposal did not include was any plan to overhaul and reorganize the public health agencies so that they could spend these new monies effectively nonetheless it represented a clear step in the right direction and a step not taken as the proposal went nowherep pit is instructive to compare this inaction to the response to the 911 terrorist attack by nov 12 2001 two months and a day after 3000 americans had perished congress had passed the patriot act and the us military had invaded afghanistan and captured kabul we can debate the wisdom of these actions and their ultimate effects but theres no doubt that american leadership recognized a serious threat and moved quickly to respond but today over twoandahalf years after the first us covid cases and with a death toll over 300 times greater than that of 911 there has still been no movement to upgrade our biodefense capabilityp pwhat are we to make of the absence of any serious attempt to bolster american state capacity to fight pandemics in the aftermath of the covid disaster at this point the other two contributors to that disaster besides lack of relevant state capacity namely inadequate political leadership and a dysfunctional political culture must come to the fore to build the requisite state capacity we need political leadership and also a political culture that if it doesnt push leaders in the right direction at least doesnt block themp plets start with political culture there is no reason to expect that public opinion will pressure politicians to do the right thing here the problem goes deeper than our toxic polarization even in wellfunctioning polities recognizing and addressing lowprobabilityhighimpact risks are not tasks that the emdemosem can be counted upon to perform well on the bright side upgrading the nations pandemic preparedness is a very different job from managing an actual crisis in the here and now it is quiet boring work unlikely to rouse great public controversy and activate polarized responses if public opinion is not where the answer lies neither does it make an answer impossiblep pit is with the nations political leadership that responsibility for preventing the next crisis inescapably resides and as the contrast of the current apathy with the immediate response to 911 reveals what is missing in our leadership at present is the proper mindset namely seeing the risk of pandemics as a key national security threata hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[7]supa p pthe risks to life and treasure posed by pandemics make them among the gravest threats we face since the eradication of smallpox fostered the complacent assumption that infectious disease is no longer a pressing problem the world has experienced two global pandemics first hivaids which over four decades has killed some a hrefhttpswwwwhointdataghodatathemeshivaidstextglobal20situation20and20trends3aat20the20end20of20202140 million peoplea worldwide and a hrefhttpswwwkfforghivaidsfactsheetthehivaidsepidemicintheunitedstatesthebasics700000 americansa and now covid19 which according to best estimates had killed a hrefhttpswwwthelancetcomarticles0140673621027963fulltextmore than 18 million peoplea worldwide by the end of 2021 with the confirmed us death count passing the a hrefhttpswwwnytimescom20220519ususcoviddeathshtml1 milliona mark in may 2022 these death tolls are in line with those of the bloodiest wars in human history the us death count from covid19 equals the countrys total losses in the civil war and world war ii combinedp pbecause the last pandemic that indiscriminately threatened the general population occurred a century ago it is tempting to think of the covid19 experience as a terrible oneoff that we just want to put behind us and forget about but there is no ground whatsoever for thinking that way we may have lost interest in deadly pathogens but they havent lost interest in us just in the current century we have already experienced a number of near misses outbreaks of communicable diseases caused by novel pathogens that for whatever reason werent transmissible enough to set the world on fire bird flu sars mers and ebola should have been wakeup calls and indeed served that function in the more attentive and directly affected parts of the world and covid19 in addition to being a tragedy of historic proportions also serves as a warning a pathogen with the same or greater transmissibility and much greater lethality could make the jump from animals to humans at any timep pas we lost our ageold fear of infectious disease over recent decades we were inadvertently creating conditions that are a hrefhttpswwwslowboringcompweshouldexpectmoreandworsepandemicsevermore favorablea for the a hrefhttpswwwcgdevorgpublicationareweenteringnewagepandemicsemergence of new pandemicsa ongoing a hrefhttpswwwnaturecomarticlesd41586020023411impingement on the habitatsa of diseasecarrying wild animals a hrefhttpswwwvoxcomfutureperfect202042221228158coronaviruspandemicriskfactoryfarmingmeatfactory farminga that puts humans in close contact with dense populations of diseasecarrying livestock and increasingly densely trafficked domestic and a hrefhttpswwwresearchgatenetpublication7133296_global_transport_networks_and_infectious_disease_spreadinternational travel networksa to spread infections around the planet while weve slept weve allowed the threat posed by our viral and microbial adversaries to escalate precipitously unless we rebuild our defenses it is only a matter of time before disaster strikes p pand if we are somehow incapable of adopting a national security mindset unless the danger to lives and wellbeing involves a human adversary we should still put pandemics at or near the top of the list of threats we face after all the most terrifying pandemic scenario is that of an artificial pathogen genetically modified to heighten its lethality and just as the risk of nuclear war extends to accidental launches the risk of biological warfare likewise extends to accidental releases from laboratories of course there is a possibility in all likelihood never to be definitely confirmed or denied that covid19 itself originated in a leak from the wuhan institute of virology regardless of what actually happened the mere fact that the lab leak theory is plausible because leaks of this kind are distressingly routine ought to convince us that we are dangerously exposed although a star warsstyle missile defense system may never be impermeable enough to prevent catastrophe in the event of a nuclear strike we can construct pathogen defense systems that can do much to protect us from biological weapons p pit is beyond the scope of this essay to lay out in detail the specific reforms needed to provide our public health authorities with the diseasefighting capacity that a national security mindset requiresa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[8]supa but here are a few of the obvious steps to takep ullifocus the cdc on infectious diseases this was the original focus of the agency but as the threat of infectious disease waned the cdcs mission creeped steadily into management of a a hrefhttpswwwcdcgovbudgetdocumentsfy2022fy2022cdcoperatingplanpdfvariety of chronic diseases and conditionsa like heart disease diabetes smoking and obesity as well as birth defects domestic violence and suicide these are all important problems but there are other government agencies more suitable to addressing them we need an agency laserfocused on acute threats from pathogens we need to restore the cdc to its original missionliliimprove data sharing spotty information exchange between the cdc and the countrys nearly 3000 state and local public health agencies has been a recurrent problem throughout the pandemic as well as during other outbreaks rationalization of reporting requirements and protocols is an absolute necessity if our diseasefighting generals are to have accurate information from the front lines and those on the front lines are to act appropriately on directives from headquarterslilifind an endrun around fdas business as usual actually such an endrun already exists in the form of emergency use authorizations such as those fda used for initial approval of covid vaccines even so fdas deepseated caution and propensity for delay were frequently in evidence during the pandemic and indeed the political incentives favoring caution are so overwhelming that it is unclear how much good can be done by further reforms that push toward accelerating the review process during public health emergencies such reforms should be attempted but perhaps the most efficacious approach would be to bypass the fda when it stalls require the agency to approve any diagnostic vaccine or treatment for use in a public health emergency provided that it has already been approved by regulators in other advanced countriesliliexpand the operation warp speed model operation warp speed offered a new and excellent model for incentivizing drug development in an emergency setting but that model was followed inconsistently and incompletely in the future the government should regularly incentivize development of new vaccines and treatments by direct funding that is through financial support for rampd and clinical trials and advance purchase agreements upon successful development instead of the usual indirect approach of awarding patents and granting temporary market exclusivity there is a hrefhttpswwwbrookingsedublogupfront20210603whyintellectualpropertyandpandemicsdontmixno justification for granting or protecting patents in the event of a pandemica patents inevitably misalign drug makers incentives with the overriding goal of accelerating global vaccine distributiona hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[9]supa lilitighten oversight and regulation of pathogenrelated research its possible that the covid19 pandemic began with a lab leak we know that lab leaks are a hrefhttpswwwindependentcouknewsworldamericasscottgottliebcovidwuhanlableaksb1856813htmlrelatively commona and we know that scientists are engaging in socalled a hrefhttpswwwvoxcom20205121243148whysomelabsworkonmakingvirusesdeadlierandwhytheyshouldstopgain of functiona research in which they are deliberately trying to create more infectious and lethal pathogens although the us imposed a moratorium on such research in 2014 it lifted the ban three years later its imperative now that we recognize a hrefhttpswwwvoxcom22937531viruslabsafetypandemicpreventionthe real potential for selfinflicted catastrophea and take steps to improve international oversight of biomedical research labs and outlaw research that poses unacceptable risks to lives around the worldliul pan absence of vital state capacity has cost hundreds of thousands of americans their lives during the covid19 pandemic and the death toll continues to mount the first step toward avoiding similar disasters in the future is to recognize the magnitude of the threat we face out there somewhere in the inky blackness of space a hrefhttpswwwyoutubecomwatchv4zv5cvg6pma comet with our names on it is heading our waya its high time we look up and prepare to defend ourselvesp div classwpcontainer2 wpblockbuttons div classwpblockbuttona classwpblockbutton__link hrefhttpswwwniskanencenterorgwpcontentuploads202210incapacitatedpdfdownloadable pdfadiv div hr classwpblockseparator psup[1]sup see my interview with a hrefhttpswwwniskanencenterorglessonsfromthepandemicwhytestingtracingandisolationnevergotoffthegroundglen weyla for an indepth discussion of these failures and their consequencesp p sup[2]sup my interview with a hrefhttpswwwniskanencenterorghowthefdaamongothersfailedusalex tabarroka addresses this point see the discussion beginning at approximately 4145p p sup[3]sup although the greater harms created by this polarization were caused by those who resisted restrictions it must be pointed out that overreliance on restrictions caused significant harms as well this was especially true in the case of school closings it became apparent early on that covid19 posed a much smaller risk to minors especially young children accordingly with appropriate testing distancing and isolation protocols a hrefhttpswwwnaturecomarticlesd4158602101826xschools could operate safely with inperson instructiona in many places however an overabundance of caution kept children out of schools for a hrefhttpswwwnytimescom20220505briefingschoolclosurescovidlearninglosshtmlfar too longap p sup[4]sup as michael lewis details in his book on the pandemic the swine flu episode back in 1976 marked a key moment in the cdcs evolution faced with the emergence of a potent influenza strain and the threat of a major outbreak in the united states the cdc launched what was planned to be a massive vaccination drive but the vaccine produced side effects the major outbreak never materialized and the vaccination effort fizzled out as an embarrassing failure in 1977 the incoming carter administration fired the cdc director a career civil servant and a few years later the reagan administration made the position of cdc director a political appointee see michael lewis emthe premonition a pandemic storyem new york ww norton amp company 2021 pp 281294 p p sup[5]sup see my interview with scott gottlieb starting around 930 see also scott gottlieb emuncontrolled spread why covid19 crushed us and how we can defeat the next pandemicem new york harper 2021 pp 93106p p sup[6]sup interview with a hrefhttpswwwniskanencenterorghowthefdaamongothersfailedusalex tabarroka starting around 4105p p sup[7]sup  in my interviews with scott gottlieb and philip zelikow both stressed the importance of viewing pandemic preparedness through a national security lens see a hrefhttpswwwniskanencenterorglessonsfromthepandemicthemistakesthatledtouncontrolledspreadgottlieb interviewa starting around 3809 and a hrefhttpswwwniskanencenterorglessonsfromthepandemictheneedforanationalcovidcommissionzelikow interviewa starting around 5035see also gottlieb emuncontrolled spreadem pp 340380p p sup[8]sup  see my interview with a hrefhttpswwwniskanencenterorglessonsfromthepandemicpreparingfornexttimenikki terana for a detailed discussion of how to improve pandemic preparednessp p sup[9]sup my interview with a hrefhttpswwwniskanencenterorglessonsfromthepandemicthefailuretothinkgloballypriti krishtela contains an extensive discussion of the larger problems with current patent policy and in particular how patents act as a drag on pandemic responsep pthe post a relnofollow hrefhttpswwwniskanencenterorgincapacitatedhowalackofstatecapacitydoomedpandemicresultsincapacitated how a lack of state capacity doomed pandemic resultsa appeared first on a relnofollow hrefhttpswwwniskanencenterorgniskanen centerap

div classwpcontainer1 wpblockbuttons div classwpblockbuttona classwpblockbutton__link hrefhttpswwwniskanencenterorgwpcontentuploads202210incapacitatedpdfdownload paperadiv div pthe covid19 pandemic august 2022 18 months case reported jan 20 2020 hrefhttpsourworldindataorgcoviddeathsnearly 500 americans died daya disease number people hospitalized given day exceeded hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerfacetnonemetrichospitalpatientsinterval7dayrollingaveragerelativetopopulationfalsecolorbytestpositivityfalsecountrydeuusa30000a worldwide confirmed daily death count remained thousandsp pdespite grim statistics fair barring emergence new deadly variant crisis stage pandemic passed united states restrictions relating closings mask wearing social distancing lifted emergency fiscal responses played globally situation similar china outlier continues persevere zero covid policy rolling lockdowns places transitioned extraordinary public health emergency grim new normal viral killer considerably lethal flu added lifes ongoing risksp plooking pandemic response administrations congresses record crisis management includes significant accomplishments breathtaking successes long dismal string missteps failures essay try identify fundamental flaws american state capacity led missteps failures lead greater death suffering future pandemics fail learn mistakesp plets start good news list development mass production effective vaccines year feat experts outset pandemic considered impossible companies pfizer moderna forefront effort pathbreaking mrna vaccines governments operation warp speed played vital role accelerating drug testing approval coordinating supply chains rapid scaleup production depended estimated hrefhttpswwwvoxcom22894978covid19vaccinelivessaveddeathsavoidedomicronchartvaccines saved 1 million american livesa 2021 globally estimated number lives saved vaccines year stands hrefhttpswwweconomistcomgraphicdetail20220707covid19vaccinessavedanestimated20mlivesduringtheirfirstyear20 millionap pmeanwhile notwithstanding different ways public health authorities botched things succeed leading country mass mobilization intensity duration counterpart american experience outside wartime time instead mobilized produce war materiel fight battles americans mobilized avoid infecting staying home masking keeping distance allofsociety effort badly misdirected times time considerably weakened growing resistance backlash simple exhaustion nonetheless stands astonishing feats concerted mass behavior modification history effort greatly aided advanced digitization economic life allowed people work home schooling albeit diminished form continue remote basis online delivery services substitute inperson shopping dining studies confirm masking social distancing effective reducing infection rates approximately hrefhttpswwwbmjcomcontent375bmj202106830250 percent 25 percenta respectively mobilization campaign flaws excesses loopholes saved large numbers lives preventing health care systems overrun keeping people safe vaccines better treatments developedp pfinally face massive economic shock caused primarily fear virus exacerbated public health restrictions congress overcame toxically polarized political climate shovel trillions dollars emergency relief spending criticize details spending packages emergency programs implemented particular inflation experiencing doubtless worse largesse look household incomes held crisis rapidly employment bounced fairest conclusion congress fiscal activism prevented terrible situation getting worsep phaving acknowledged silver linings time face black cloud overall pandemic response judged shocking dispiriting failure 2022 16 months pandemic confirmed death toll passed hrefhttpswwwnytimescom20220519ususcoviddeathshtml1 milliona sixfigure annual death tolls look likely going forward foreseeable future cumulative covid mortality rate aug 31 2022 hrefhttpsourworldindataorgcoviddeaths310 deaths 100000 peoplea highest advanced democracy way comparison cumulative mortality rate united kingdom 305 100000 italy 296 france 229 sweden 189 germany 177 norway 74 japan 32p h2stronganatomy megadeathstrongh2 pmany millions words written americas fumbling response pandemic ive read lots ive hrefhttpswwwniskanencenterorglessonsfromthepandemicavideointerviewseriesintervieweda number experts indepth discussions aspects story doubt details come light time official inquires conducted definitive histories written broad outlines went wrong occasionally went right abundantly clearp pthere major reasons covid19 deadlier united states peer countries confirmed infection late matter ie emergence highly transmissible omicron variant american authorities proved incapable standing executing testing sufficient scale enable effective public health screening followup contact tracing coordination support isolation sick exposed accordingly possible identify locate outbreaks early drive transmission rates suppress virus result vaccines available authorities forced rely blunderbuss tool indiscriminate closings social distancing mandates infections deaths failures testing tracing supported isolation account vast majority nearly 350000 confirmed deaths 2020a hrefhttpswwwniskanencenterorgincapacitatedhowalackofstatecapacitydoomedpandemicresultsendnote1sup[1]supa comparison wellmanaged countries kept fatalities check prevaccine prevariant phase pandemic australia south korea saw 900 confirmed deaths japan fewer 3500 taiwan registered seven confirmed covid deaths yearp pthe second reason despite developing effective vaccines getting big jump world vaccine distribution united states ended achieving considerably lower vaccination rates advanced countries aug 31 2022 hrefhttpsourworldindataorgcovidvaccinations68 percent populationa fully vaccinated compared 75 percent united kingdom 76 percent germany 79 percent france 82 percent japan 84 percent australia united states lagged badly booster shots important controlling severity illness transmissible delta omicron variants aug 24 2022 hrefhttpsourworldindataorggraphercovidvaccineboosterdosespercapitacountryusaausfradeujpn39 booster doses administered 100 peoplea compared 55 australia 60 united kingdom 63 france 70 germany 85 japanp phow apportion blame signal failures nominate leading candidates 1 failures political leadership 2 lack relevant hrefhttpswwwniskanencenterorgtruststatecapacityandtheepidemiologicalmysteryofcovidstate capacitya 3 problems underlying political culture culture broadly state capacity hard amass wield bear measure responsibility purpose essay case importance 2 discuss lack relevant state capacity absence appropriate governing structures organization capabilities focus played critical role undermining pandemic response task building missing capacity priority seeking prevent similar catastrophe futurep pbut lets look candidates political leadership obvious question arises trumps fault sure singularly unfortunate gravest public health crisis century occurred presidency spectacularly unfit individual hold office 2020 essentially abdicated federal role testing tracing isolation spoke repeatedly widespread testing covid case numbers look bad refused wear masks encouraged backlash public health restrictions peddled quack cures hard imagine irresponsible leaderp pdespite means clear things gone better hillary clinton president instead centers disease control preventions disastrous misfires testing likely occurred political polarization sowed seeds resistance backlash restrictions preceded 2016 election assuredly pacified clinton victory spite trumps personal clownishness administration conceive execute operation warp speed reason assume reason doubt clinton administration good job vaccine developmenta hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[2]supap pmeanwhile return normalcy joe biden hasnt sufficed turn things ill discuss later biden administrations record things pandemicrelated kindly stellar short problems led americas failed pandemic response deeper trump preceded persisted departurep pamericas highly polarized political culture clearly played role driving fatalities pandemic organized backlash public health mandates restrictions doubtless reduced compliance increased chances virus spread variety reasons difficult connect variation compliance nonpharmaceutical interventions npis variations infections hospitalizations deaths vaccinations impacts easier trace variation vaccination rates partisan divide stark according hrefhttpsmorningconsultcomcovid19vaccinedashboardjuly 2022 surveya 83 percent democrats reported vaccinated compared 63 percent republicans 17 percent democrats vaccinated half said unwilling shots 38 percent unvaccinated republicans threequarters said unwilling vaccinated effect relatively low vaccination rate fatalities significant study brown university school public health estimates hrefhttpsglobalepidemicsorgvaccinationsover 300000a millionplus covid deaths avoided vaccinationsp pyet pandemic response run according global best practices outset limited scope political polarization drive events appropriate testing tracing programs place initial outbreaks virus isolated suppressed need mass restrictions indefinite duration backlash time vaccines available contrast largely diseasefree united states largescale suffering world likely bolstered trust public health authorities reduced resistance vaccinationp pmy conclusion governance failures inability american public health authorities job widely considered best world primary reason countrys poor record dealing pandemic overwhelming majority nearly 350000 fatalities 2020 ie vaccines avoided accomplishment saved 300000plus avoidable deaths caused vaccine resistancep h2stronga failure imaginationstrongh2 pthe specific nature breakdown state capacity fault clear battle lines polarization pandemic country split increasing bitterness rancor mandates restrictions early days poles split reversed people right talked strict limits international travel people left minimized threat denounced travel restrictions veiled racism relatively quickly opposing sides switched places dug right severity virus minimized closures social distancing requirements mask mandates denounced tyrannical overkill left took virus seriously taking seriously meant embracing restrictions maintaining indefinitely vaccines developed sides stuck positions people right tended discount vaccines safety efficacy people left tended minimize relevance vaccine availability case maintaining restrictionsa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[3]supap pin words americans split simply surrender virus let run rampant hide indefinitely emerged widely embraced option prevaccine phase pandemic public health authorities able provide alternative surrender hide forever defeat virus critical absence state capacity display pandemic inability develop manage communicate strategy victory use testing tracing isolation suppress virus altogether pending successful suppression develop deploy protective technologies highquality masks improved ventilation air filtration hrefhttpswwwnaturecomarticless4159802208462zfarultraviolet lighta allow people function safely public expedite development effective vaccines treatments ultimately return status quo ante virus component strategy partially implemented tens millions lives saved world result elements got groundp pthe failure formulate execute strategy victory failure imagination failure shake emcompliance mindsetem wedded following established procedures adopt instead emwarfighting mindsetem dedicated achieving desired results government agencies rely established procedures lacking clear market feedback private businesses receive daily basis public sector forced lean heavily fidelity process ensuring accountability officials notorious vulnerability gives bureaucracy bad pronounced tendency prioritize looking backward rulebook looking forward advancing agencys missionp pbut crisis acute threat public safety order feedback problem dissipates objective government action metrics judging efficacy gravely clear essential question junctures government recognize change circumstances adapt accordingly clearly military affairs stark differences peacetime army successful wartime army peacetime leaders frequently rise basis skill playing political games ingratiating superiors amassing larger budgets etc war comes army risks annihilation devise winning strategy find leaders execute strategyp pthe outbreak infectious disease akin outbreak war invasion deadly foreign adversary threatens life public order mass scale decline recently infectious disease major threat general population rich countries lulled public health authorities complacency development antibiotics vaccines promised end ageold scourge infectious disease promise upheld spectacularly global eradication smallpox 1980 communicable disease receded clear present danger public health authorities steadily shifted focus chronic health problems cancer heart disease obesity drug abuse likep psince victory smallpox ancient adversary staging comeback thanks rise antibiotic resistance ongoing human encroachment habitats diseasecarrying wildlife spread factory farming livestock disease vectors intensification domestic global travel came hivaids outside africa concentration gay men tragically muted warning signal 21st century seen outbreaks bird flu swine flu sars mers zika ebola sufficient inroads richcountry populations significantly alter perceptions threat level luck ran late 2019 precisely century end global pandemicp pin taiwan bad experience sars helped banish complacency poor handling mers south korea similar effect united states nearmisses earlier century sufficed impress public health authorities political leaders country adequately prepared direct hit direct hit came proved impossible deeply entrenched organizational cultures public health system turn dime switch war modep h2strongpeacetime agencies wartime challengesstrongh2 pthe cdc entered pandemic reputation worlds leading diseasefighting agency respects reputation deserved houses worldclass expertise conducts vitally important research cdc past originated world war ii military program control malaria southern united states spearheaded hugely successful smallpox eradication efforts africa later globally longer oriented directing action field largescale crisis managementa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[4]supa cdc peacetime agency focused conducting academic research preparing invasion food drug administration commissioner scott gottlieb hrefhttpstwittercomscottgottliebmdstatus1426890092036202499commenteda cdc retrospective agency business gathering realtime info requires analytical work providing partial answersp pthe cdc notoriously produced test kit didnt work approach testing fatally flawed chance standing adequate testing capability participation big private labs capable producing administering tests sufficient scale cdc history working private labs preferred work conjunction small network public labs zika scare 201516 painfully apparent approach insufficient handle outbreak cdc fell supplying tests developed new test didnt work old failed supply test commercial labs ramp supplya hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[5]supa result adequate testing track progress disease zika mosquitoborne illness spreads far slowly airborne novel coronavirus despite widespread criticism cdcs handling zika changed cdc jealously guarded institutional control testing adapting face failurep pbeyond problems testing impossible develop actionable intelligence location enemy cdc proved incapable assimilating incoming intelligence nature virus applying successfully response efforts backwardlooking academic culture focused generating publishable research results inimical kind intellectual nimbleness flexibility needed operate fog war spectacular failure regard cdcs dogged refusal recognize virus spread aerosolized airborne transmission small saliva droplets early pandemic pattern infection superspreader events example aboard hrefhttpswwwnytimescom20200730healthdiamondprincesscoronavirusaerosolhtmldiamond princessa cruise ship hrefhttpseditioncnncom20200513uscoronaviruswashingtonchoiroutbreaktrndindexhtmlchoir practicea washington state suggested strongly airborne transmission likely wasnt hrefhttpswwwusatodaycomstorynewshealth20201005covidcdcupdatesguidelinesincludeairbornetransmission3627932001october 2020a months crisis cdc grudging admission airborne transmission possible discounting importance hrefhttpswwwnytimescom20210507healthcoronavirusairbornethreathtmlmay 2021a cdc finally issue guidance properly acknowledged threat airborne transmissionp pa domino effect missteps ensued intelligence failure overemphasis saliva droplets led misplaced fear surface transmission enormous amounts wasted effort hrefhttpswwwtheatlanticcomideasarchive202007scourgehygienetheater614599hygiene theatera parks closed outdoor activities restricted spending time outside safest thing indoor spaces maintaining 6 feet distance people holy writ pressing issues ventilation air filtration badly underemphasizedp panother major intelligence blunder involving cdc elements national global public health establishment concerned use face masks early public health authorities discouraged use masks general public misreading evidence concerning utility underhanded effort reserve dwindling supplies health care workers flipflopping outset crisis gave clear evidence experts charge werent fallible untrustworthy helping set stage resistance backlash comep pthe federal agency leading role managing pandemic food drug administration charge approving new diagnostics vaccines treatments like cdc fda came pandemic deeply entrenched institutional culture inimical effective crisis management dating way hrefhttpspubmedncbinlmnihgov21507989thalidomide disastera late 1950s fda prioritized keeping unsafe drugs market expediting approval new safe effective drugs politics asymmetry understandable drug approval backfired create known victims causing public firestorm grievously compromising fdas reputation identities people die result delays approval new drug generally known economist alex tabarrok refers hidden victims delay fdas hrefhttpsmarginalrevolutioncommarginalrevolution202101theinvisiblegraveyardisinvisiblenomorehtmlinvisible graveyarda outbreak communicable disease victims visible pile rapidlyp pyet fda carried peacetime institutional caution pandemic early contributed testing debacle improperly asserting jurisdiction approval labdeveloped tests backing fair participation operation warp speed rouse agency usual torpor temporarily fda showed unaccustomed flexibility expediting clinical trials new vaccines old habits quickly reasserted pfizer submitted emergency use authorization mrna vaccine nov 20 2020 fda waited dec 10 schedule meeting consider application time basically closed days thanksgiving holiday nearly 40000 americans died interim fda approved astrazeneca vaccine despite successful use world cdc imposed misguided temporary pause use johnson amp johnson vaccine dealing blow public confidence drug dragged feet approval athome covid test kits readily available europe months herep pas colleague hrefhttpswwwslowboringcompflexiblehealthmatthew yglesiasa noted slow boring blog public health authorities asked expected american public incredible flexibility upending lives common good working home masking distancing supervising kids remote education missing weddings funerals asked proved unable faced unprecedented crisis rapid action basis incomplete information path victory chose stick established rules procedures adaptation improvisation called weve changed lot cope pandemic yglesias wrote institutions charged protecting stayed rigidp pthat rigidity proved depressingly durable revealed recent course global monkeypox outbreak nations public health authorities remain stuck bureaucratized amber monkeypox infection confirmed 19 2022 aug 22 hrefhttpswwwcdcgovpoxvirusmonkeypoxresponse2022worldmaphtmlus 15000 confirmed casesa world total 43000 virus able spread rapidly failed adequate testing contact tracing cdc reprised role bottleneck hrefhttpswwwstatnewscom20220527monkeypoxtestcapacitycdcconsidersexpandinginsisting beginninga tests run network public labs sent agency confirmation furthermore hrefhttpswwwmsncomenusnewsusafterrepeatingearlycovidmistakesusnowhastheworldsbiggestmonkeypoxoutbreakaraa10im7hlibbnb7kzdoctors requireda state health department authorization test slowing things cdc expand testing include commercial labs hrefhttpswwwhhsgovaboutnews20220622hhsexpandingmonkeypoxtestingcapacityfivecommerciallaboratorycompanieshtmllate junea end june hrefhttpswwwnytimescom20220730opinionmonkeypoxpublichealthfailurehtmlsmidtwnytopinionsmtypcuronly 2000 testsa completedp pfortunately time vaccines treatments created similar far deadlier smallpox virus known years disease endemic africa jump shores plane flight hrefhttpswwwnytimescom20220801nyregionmonkeypoxvaccinejynneosushtmlwe allowed stockpilea new stateoftheart vaccine dwindle 2400 doses vaccinate 1200 people millions doses warehoused unmixed freezedried form netherlands 14 million doses filled ready shipment case biden administration ordered 372000 vaccine doses shipped united states millionplus doses couldnt shipped fda gotten inspecting drug makers new fillfinish facility inspection occur end june month case vaccine distribution fell badly demand asked delays getting doses government spokesperson said delays severe counted hrefhttpswwwnytimescom20220725nyregionnycmonkeypoxvaccinedosesdenmarkhtmlbusiness daysa administration ordered millions doses bulk supply monthsp pinadequate testing cdc controlfreakery leisurely fda approval schedules sound familiar dj vu moments coming hrefhttpswwwtheatlanticcomnewslettersarchive202207usmessagingonmonkeypoxisdeeplyflawed670573messaginga public mess monkeypox cases outside africa heavily concentrated gay men cdc health authorities buried fact public pronouncements fear creating stigma improvisations best bad situation officially discouraged promoted despite strong evidence single dose monkeypox vaccine confers good protection hrefhttpswwwscienceorgcontentarticletheresshortagemonkeypoxvaccinecouldonedoseinsteadtwosufficethe cdc fda warned againsta adopting doses vaccination strategy stretch limited supplies drug fortunately new york city health department hrefhttpswwwstatnewscom20220715nyconedosemonkeypoxstrategycdcfdawarningsagainstignored federal warningsa proceeded maximize availability dosesp pone glimmer hopeful news aug 17 2022 cdc director hrefhttpswwwnytimescom20220817uspoliticscdcrochellewalenskycovidhtmlrochelle walenskya announced plans reorganize agency publicly admitting major failures pandemic frank responsible pretty dramatic pretty public mistakes testing data communications walensky said reform plans focus shifting cdcs focus away academic research rapidly sharing data translating research practically useful intelligence guidancep palthough overall outlines reorganization initiative look sound limits purely internal reforms accomplish walensky noted plans hrefhttpswwwstatnewscom20220817cdcambitiousoverhaulcovidmisstepsdepend congressional actiona including requiring state local authorities share data cdc providing additional funding doubtful deep cultural change needed accomplished thoroughgoing shakeup agency resetting priorities congressp h2strongthe path partially takenstrongh2 pthe area pandemic response met exceeded expectations vaccine development thanks particular trump administrations operation warp speed initiative ows partnership department health human services department defense sought accelerate development distribution vaccines variety mechanisms selected vaccine candidates different platforms ie different types vaccines diversified portfolio maximized chances finding winner early entered advance purchase contracts drug makers agreeing purchase large volumes attractive prices firm came approved drug provided billions financial support expedite vaccine development clinical trials rampup manufacturing capacity pfizer accept funds ows partner biontech received hundreds millions dollars support german government allowed companies run different phases clinical trials concurrently accelerate approval process worked participants expand manufacturing capacity approval distribution begin soon possible worked producers suppliers identify resolve supply chain problems competing firms work crosspurposes ramping productionp pthe result spectacular historic success deserves mentioned breath manhattan project berlin airlift project apollo return glory alex tabarrok calls american model innovation getting visible hand invisible hand work combining spending power federal government innovativeness speed americas incredibly sophisticated private companiesa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[6]supap poperation warp speed succeeded shifted innovation policy peacetime wartime mode normal peacetime conditions government general interest encouraging innovation unable predict promising avenues commercially viable technological progress lie accordingly trying aim private efforts particular projects government offers general incentive form patents come new nonobvious useful find market enjoy temporary market exclusivity ensure recoup investment earn healthy return wartime conditions pandemic situation different government knows exactly kind technological progress urgently needed diagnostics vaccines treatments particular pathogen situations upfront rampd support advance purchase agreements guarantee healthy return development desired product offer focused targeted incentives necessary need defer private companies figure innovations commercialized government purchaser tell companies wants government needs relevant purchaser dont want access vaccines contingent ability payp poperation warp speeds tragic flaw model applied widely obviously initial stumble testing ows test kits sensitive pcr tests cheaper faster antigen tests blanketed country ubiquitous testing capacity pandemic swing possible set testing isolation protocols allow essential businesses activities continue operating safely nfl completing season contact sport resort selfisolated bubble number universities regular testing stay open ubiquitous cheap tests available outlier success stories normp pthe ows model extended encompass personal protective equipment massive quantities face masks surgical masks n95 masks afford better protection gone developed nextgeneration ppe masks headgear easy wear comfortable longer use safep peven vaccines operation warp speed remained partially stuck peacetime mode incentivized appropriately advance purchase agreements government research support drug makers allowed retain patent rights case moderna national institutes health actually held patents key elements vaccine firms government bought patent rights asserted licensing authority laws hrefhttpscrsreportscongressgovproductpdflsblsb10422marchin rights bayhdole act section 1498a allow government use intellectual property compensation way government dramatically accelerated global vaccine distribution directing ows participants share technology manufacturing knowhow capable producers lessdeveloped countriesp pthe chance truly suppress virus endemic achieve high rates highly effective vaccination world late august 2022 global vaccination rate stands hrefhttpsourworldindataorgcovidvaccinations63 percenta hrefhttpswwwtheguardiancomglobaldevelopment2022jul21covidvaccinefigureslaybareglobalinequalityasglobaltargetmissedworlds poorest countriesa 20 percent people fully vaccinated vaccines longer highly effective new variants virus emerged transmit fairly easily notwithstanding vaccination inoculation continues offer strong protection severe illness death line horses long stable novel coronavirus years comep pmeanwhile operation warp speed discontinued biden administration equivalent effort fund expedite nextgeneration vaccines instituted continue use vaccines designed original novel coronavirus bright pfizer moderna developed bivalent boosters target original virus currently dominant ba5 omicron subvariant actually designed nowsuperseded hrefhttpswwwslowboringcompweregettinganomicronoptimizedba1 subvarianta substantially effective ba5 fda granted emergency use authorization boosters aug 31 2022 hrefhttpswwwslowboringcompwecouldhaveuniversalcovidvaccinesmore promising vaccinesa remain development including nasal vaccines effectively block transmission socalled panvariant vaccines alas current schedules new vaccines unlikely available 2024 operation warp speed equivalent place important weapons antipandemic arsenal available soonerp h2strongplease look upstrongh2 pone expected failures pandemic response produce sufficient shock system catalyze major change mentioned cdc credit conducted internal review planning important reforms sweeping organizational changes significant funding increases needed create worldclass pandemicfighting state capacity occur new legislation far virtually appetite congress biden administration taking challengep pthe pandemicrelated reform legislation headway date prevent pandemics act cosponsored senators patty murray richard burr modest bill potentially useful things including establishing permanent white house office pandemic preparedness authorizing national task force conduct extensive postmortem countrys pandemic response mandating better information sharing cdc state local health authorities far cry comprehensive changes called prospects passage far bright bill advanced senate health education labor pensions committee march 22 found way senate floor companion bill housep pthe biden administration september 2021 proposed 10year 65 billion hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20210903factsheetbidenadministrationtotransformcapabilitiesforpandemicpreparednessspending packagea upgrade countrys pandemic preparedness proposal based recommendations hrefhttpsbiodefensecommissionorgreportstheapolloprogramforbiodefensewinningtheraceagainstbiologicalthreatsbipartisan commission biodefensea cochaired joe lieberman tom ridge called creating vaccines variety pathogens genomic sequencing clinical data establish early warning system outbreaks developing nextgeneration ppe replenishing key stockpiles proposal include plan overhaul reorganize public health agencies spend new monies effectively nonetheless represented clear step right direction step taken proposal went nowherep pit instructive compare inaction response 911 terrorist attack nov 12 2001 months day 3000 americans perished congress passed patriot act military invaded afghanistan captured kabul debate wisdom actions ultimate effects theres doubt american leadership recognized threat moved quickly respond today twoandahalf years covid cases death toll 300 times greater 911 movement upgrade biodefense capabilityp pwhat absence attempt bolster american state capacity fight pandemics aftermath covid disaster point contributors disaster lack relevant state capacity inadequate political leadership dysfunctional political culture come fore build requisite state capacity need political leadership political culture doesnt push leaders right direction doesnt block themp plets start political culture reason expect public opinion pressure politicians right thing problem goes deeper toxic polarization wellfunctioning polities recognizing addressing lowprobabilityhighimpact risks tasks emdemosem counted perform bright upgrading nations pandemic preparedness different job managing actual crisis quiet boring work unlikely rouse great public controversy activate polarized responses public opinion answer lies answer impossiblep pit nations political leadership responsibility preventing crisis inescapably resides contrast current apathy immediate response 911 reveals missing leadership present proper mindset seeing risk pandemics key national security threata hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[7]supap pthe risks life treasure posed pandemics gravest threats face eradication smallpox fostered complacent assumption infectious disease longer pressing problem world experienced global pandemics hivaids decades killed hrefhttpswwwwhointdataghodatathemeshivaidstextglobal20situation20and20trends3aat20the20end20of20202140 million peoplea worldwide hrefhttpswwwkfforghivaidsfactsheetthehivaidsepidemicintheunitedstatesthebasics700000 americansa covid19 according best estimates killed hrefhttpswwwthelancetcomarticles0140673621027963fulltextmore 18 million peoplea worldwide end 2021 confirmed death count passing hrefhttpswwwnytimescom20220519ususcoviddeathshtml1 milliona mark 2022 death tolls line bloodiest wars human history death count covid19 equals countrys total losses civil war world war ii combinedp pbecause pandemic indiscriminately threatened general population occurred century ago tempting think covid19 experience terrible oneoff want forget ground whatsoever thinking way lost interest deadly pathogens havent lost interest current century experienced number near misses outbreaks communicable diseases caused novel pathogens reason werent transmissible set world fire bird flu sars mers ebola wakeup calls served function attentive directly affected parts world covid19 addition tragedy historic proportions serves warning pathogen greater transmissibility greater lethality jump animals humans timep pas lost ageold fear infectious disease recent decades inadvertently creating conditions hrefhttpswwwslowboringcompweshouldexpectmoreandworsepandemicsevermore favorablea hrefhttpswwwcgdevorgpublicationareweenteringnewagepandemicsemergence new pandemicsa ongoing hrefhttpswwwnaturecomarticlesd41586020023411impingement habitatsa diseasecarrying wild animals hrefhttpswwwvoxcomfutureperfect202042221228158coronaviruspandemicriskfactoryfarmingmeatfactory farminga puts humans close contact dense populations diseasecarrying livestock increasingly densely trafficked domestic hrefhttpswwwresearchgatenetpublication7133296_global_transport_networks_and_infectious_disease_spreadinternational travel networksa spread infections planet weve slept weve allowed threat posed viral microbial adversaries escalate precipitously rebuild defenses matter time disaster strikesp pand incapable adopting national security mindset danger lives wellbeing involves human adversary pandemics near list threats face terrifying pandemic scenario artificial pathogen genetically modified heighten lethality risk nuclear war extends accidental launches risk biological warfare likewise extends accidental releases laboratories course possibility likelihood definitely confirmed denied covid19 originated leak wuhan institute virology regardless actually happened mere fact lab leak theory plausible leaks kind distressingly routine ought convince dangerously exposed star warsstyle missile defense system impermeable prevent catastrophe event nuclear strike construct pathogen defense systems protect biological weaponsp pit scope essay lay detail specific reforms needed provide public health authorities diseasefighting capacity national security mindset requiresa hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[8]supa obvious steps takep ullifocus cdc infectious diseases original focus agency threat infectious disease waned cdcs mission creeped steadily management hrefhttpswwwcdcgovbudgetdocumentsfy2022fy2022cdcoperatingplanpdfvariety chronic diseases conditionsa like heart disease diabetes smoking obesity birth defects domestic violence suicide important problems government agencies suitable addressing need agency laserfocused acute threats pathogens need restore cdc original missionliliimprove data sharing spotty information exchange cdc countrys nearly 3000 state local public health agencies recurrent problem pandemic outbreaks rationalization reporting requirements protocols absolute necessity diseasefighting generals accurate information lines lines act appropriately directives headquarterslilifind endrun fdas business usual actually endrun exists form emergency use authorizations fda initial approval covid vaccines fdas deepseated caution propensity delay frequently evidence pandemic political incentives favoring caution overwhelming unclear good reforms push accelerating review process public health emergencies reforms attempted efficacious approach bypass fda stalls require agency approve diagnostic vaccine treatment use public health emergency provided approved regulators advanced countriesliliexpand operation warp speed model operation warp speed offered new excellent model incentivizing drug development emergency setting model followed inconsistently incompletely future government regularly incentivize development new vaccines treatments direct funding financial support rampd clinical trials advance purchase agreements successful development instead usual indirect approach awarding patents granting temporary market exclusivity hrefhttpswwwbrookingsedublogupfront20210603whyintellectualpropertyandpandemicsdontmixno justification granting protecting patents event pandemica patents inevitably misalign drug makers incentives overriding goal accelerating global vaccine distributiona hrefhttpswwwniskanencenterorgwpadminpostphppost11492actioneditendnote1sup[9]supalilitighten oversight regulation pathogenrelated research possible covid19 pandemic began lab leak know lab leaks hrefhttpswwwindependentcouknewsworldamericasscottgottliebcovidwuhanlableaksb1856813htmlrelatively commona know scientists engaging socalled hrefhttpswwwvoxcom20205121243148whysomelabsworkonmakingvirusesdeadlierandwhytheyshouldstopgain functiona research deliberately trying create infectious lethal pathogens imposed moratorium research 2014 lifted ban years later imperative recognize hrefhttpswwwvoxcom22937531viruslabsafetypandemicpreventionthe real potential selfinflicted catastrophea steps improve international oversight biomedical research labs outlaw research poses unacceptable risks lives worldliul pan absence vital state capacity cost hundreds thousands americans lives covid19 pandemic death toll continues mount step avoiding similar disasters future recognize magnitude threat face inky blackness space hrefhttpswwwyoutubecomwatchv4zv5cvg6pma comet names heading waya high time look prepare defend ourselvesp div classwpcontainer2 wpblockbuttons div classwpblockbuttona classwpblockbutton__link hrefhttpswwwniskanencenterorgwpcontentuploads202210incapacitatedpdfdownloadable pdfadiv div hr classwpblockseparator psup[1]sup interview hrefhttpswwwniskanencenterorglessonsfromthepandemicwhytestingtracingandisolationnevergotoffthegroundglen weyla indepth discussion failures consequencesp p sup[2]sup interview hrefhttpswwwniskanencenterorghowthefdaamongothersfailedusalex tabarroka addresses point discussion beginning approximately 4145p p sup[3]sup greater harms created polarization caused resisted restrictions pointed overreliance restrictions caused significant harms especially true case school closings apparent early covid19 posed smaller risk minors especially young children accordingly appropriate testing distancing isolation protocols hrefhttpswwwnaturecomarticlesd4158602101826xschools operate safely inperson instructiona places overabundance caution kept children schools hrefhttpswwwnytimescom20220505briefingschoolclosurescovidlearninglosshtmlfar longap p sup[4]sup michael lewis details book pandemic swine flu episode 1976 marked key moment cdcs evolution faced emergence potent influenza strain threat major outbreak united states cdc launched planned massive vaccination drive vaccine produced effects major outbreak materialized vaccination effort fizzled embarrassing failure 1977 incoming carter administration fired cdc director career civil servant years later reagan administration position cdc director political appointee michael lewis emthe premonition pandemic storyem new york ww norton amp company 2021 pp 281294p p sup[5]sup interview scott gottlieb starting 930 scott gottlieb emuncontrolled spread covid19 crushed defeat pandemicem new york harper 2021 pp 93106p p sup[6]sup interview hrefhttpswwwniskanencenterorghowthefdaamongothersfailedusalex tabarroka starting 4105p p sup[7]sup interviews scott gottlieb philip zelikow stressed importance viewing pandemic preparedness national security lens hrefhttpswwwniskanencenterorglessonsfromthepandemicthemistakesthatledtouncontrolledspreadgottlieb interviewa starting 3809 hrefhttpswwwniskanencenterorglessonsfromthepandemictheneedforanationalcovidcommissionzelikow interviewa starting 5035see gottlieb emuncontrolled spreadem pp 340380p p sup[8]sup interview hrefhttpswwwniskanencenterorglessonsfromthepandemicpreparingfornexttimenikki terana detailed discussion improve pandemic preparednessp p sup[9]sup interview hrefhttpswwwniskanencenterorglessonsfromthepandemicthefailuretothinkgloballypriti krishtela contains extensive discussion larger problems current patent policy particular patents act drag pandemic responsep pthe post relnofollow hrefhttpswwwniskanencenterorgincapacitatedhowalackofstatecapacitydoomedpandemicresultsincapacitated lack state capacity doomed pandemic resultsa appeared relnofollow hrefhttpswwwniskanencenterorgniskanen centerap

6358bab3787ded57cc6419b2

White House says Ukraine aid 'will remain strong' amid fallout from progressive letter

pthe white house on tuesday said that us support for ukraine quotwill remain strongquot until the war with russia is over comments that come after the congressional progressive caucus withdrew a letter it sent to president biden on his ukraine strategy after sparking backlash p pour support for ukraine will remain strong until the end of this war press secretary karine jeanpierre said adding that she had no comment on the letter itselfp pthe letter which was withdrawn on tuesday amid blowback over its release on monday asked biden to push harder for peace negotiations with russiap pjeanpierre said that its up to ukrainian president volodymyr zelensky to decide when or if to negotiate with the russians to end the warp pour job as we see it today as weve seen it for this past year more than a year is to make sure that ukraine has what it needs on the ground as we see this war happening in ukraine jeanpierre said were doing this to strengthen their hand not just on the battlefield but if they choose if ukraine chooses to negotiate but again that is up to president zelensky and he will make that decision for his countryp pcongressional progressive caucus chairwoman pramila jayapal dwash a relnoreferrer noopener hrefhttpsthehillcomhomenewshouse3703331progressivecaucuswithdrawsletteronukrainestrategyamidblowback target_blankwhile issuing the unusual backtrack on tuesdaya said in a statement that the letter was released by staff without vettingp pmany of the houses top liberals signed on to the official memo written by jayapal who also said its been conflated with the gop opposition and is a distraction at this time the hill reported earlier on tuesday that the letter was written over the summerp pbecause of the timing our message is being conflated by some as being equivalent to the recent statement by republican leader mccarthy threatening an end to aid to ukraine if republicans take over she said referring to widely criticized remarks from house minority leader kevin mccarthy rcalif in a recent interview that a gop majority would not give a blank check to ukrainep

pthe white house tuesday said support ukraine quotwill remain strongquot war russia comments come congressional progressive caucus withdrew letter sent president biden ukraine strategy sparking backlash p pour support ukraine remain strong end war press secretary karine jeanpierre said adding comment letter itselfp pthe letter withdrawn tuesday amid blowback release monday asked biden push harder peace negotiations russiap pjeanpierre said ukrainian president volodymyr zelensky decide negotiate russians end warp pour job today weve seen past year year sure ukraine needs ground war happening ukraine jeanpierre said strengthen hand battlefield choose ukraine chooses negotiate president zelensky decision countryp pcongressional progressive caucus chairwoman pramila jayapal dwasha relnoreferrer noopener hrefhttpsthehillcomhomenewshouse3703331progressivecaucuswithdrawsletteronukrainestrategyamidblowback target_blankwhile issuing unusual backtrack tuesdaya said statement letter released staff vettingp pmany houses liberals signed official memo written jayapal said conflated gop opposition distraction time hill reported earlier tuesday letter written summerp pbecause timing message conflated equivalent recent statement republican leader mccarthy threatening end aid ukraine republicans said referring widely criticized remarks house minority leader kevin mccarthy rcalif recent interview gop majority blank check ukrainep

6358bb07787ded57cc6419bc

Biden gets his COVID shot on camera amid effort to convince others to get vaccinated

ppresident biden on tuesday received his updated covid19 vaccination shot on camera using the moment to call on members of the public to get their bivalent covid19 booster shots ahead of the winter monthsp pthe truth is not enough people are getting it weve got to change that so we all can have a safe and healthy holiday season biden said in remarks at the white housep pas a country we have a choice to make can we repeat what happened in the past winter more infections more hospitals more loved ones getting sick even dying from the virus or can we have a much better winter he addedp pbiden then received his dose of the bivalent omicronspecific shot which comes almost three months exactly after he tested positive for covid19 for the first timep pbiden was joined for his shot by white house chief medical adviser anthony fauci covid19 response coordinator ashish jha and surgeon general vivek murthy as well as representatives from health care retailers such as walgreens cvs and rite aidp pthe president encouraged americans to use paxlovid if they have covid19 and to get tested if they think they have covid19 he mentioned the federal program to provide free tests to americans is paused because congress didnt allocate new funding for it p phe called on congress to provide more covid19 funding saying quotsome members of congress say they want to move beyond covid but they dont want to spend the money to do itquotp padditionally biden said that most americans should get a covid19 shot once a yearp pin other words its just like the flu shot he said for most americans one covid shot each year will be all that they needp pp

ppresident biden tuesday received updated covid19 vaccination shot camera moment members public bivalent covid19 booster shots ahead winter monthsp pthe truth people getting weve got change safe healthy holiday season biden said remarks white housep pas country choice repeat happened past winter infections hospitals loved ones getting sick dying virus better winter addedp pbiden received dose bivalent omicronspecific shot comes months exactly tested positive covid19 timep pbiden joined shot white house chief medical adviser anthony fauci covid19 response coordinator ashish jha surgeon general vivek murthy representatives health care retailers walgreens cvs rite aidp pthe president encouraged americans usepaxlovidif covid19 tested think covid19 mentioned federal program provide free tests americans paused congress didnt allocate new funding itp phe called congress provide covid19 funding saying quotsome members congress saytheywant covid dont want spend money itquotp padditionally biden said americans covid19 shot yearp pin wordsitsjust like flu shot said americans covid shot year needp pp

635d648522d31a251bbcbffc

A “Safety Emergency” Happened at the Wuhan Institute of Virology in November of 2019

ppropublica with vanity fair is putting their reputation on the line with a a hrefhttpswwwpropublicaorgarticlesenatereportcovid19originwuhanlabvery damning reporta suggesting covid emerged from a lab leak at the wuhan institute of virology the new information isnt about the virus but about political reports that indicate that there was some kind of emergency at the lab in november of 2019 an emergency that was so serious xi himself got involvedp blockquote p datappblocktypecopy datappid260 we sent key documents to experts on ccp communications they told us that the wiv dispatches did indeed signal that the institute faced an acute safety emergency in november 2019 that officials at the highest levels of the chinese government weighed in and that urgent action was taken in an effort to address ongoing safety issues the documents do not make clear who was responsible for the crisis which laboratory it affected specifically or what the exact nature of the biosafety emergency wasp p datappblocktypecopy datappid280[we] separately got three experts on ccp communications to review the wiv meeting summary all agreed that it appeared to be urgent nonroutine and related to some sort of biosafety emergency two also agreed that it appeared xi himself had issued a piship p datappblocktypecopy datappid610a former senior us intelligence official said that while the pishi [a hrefhttpschinamediaprojectorgthe_ccp_dictionarywrittencommentlinka at] in the dispatch is not necessarily a smoking gun he reads it as saying that there is some issue related to lab security which doesnt come up very often that needed to be seen by xi jinping he added something signed off on by the general secretary xi and premier li is high priorityp blockquote p datappblocktypecopy datappid610there is also this which i have long found surprisingp blockquote p datappblocktypecopy datappid270the interim report also raises questions about how quickly vaccines were developed in china by some teams including one led by a military virologist named zhou yusen the report called it unusual that two military covid19 vaccine development teams were able to reach early milestones even faster than the major drug companies who were part of the us governments operation warp speed programp p datappblocktypecopy datappid280vanity fair and propublica spoke to experts who said that the timeline of zhous vaccine development seemed unrealistic if not impossible two of the three experts said it strongly suggested that his team must have had access to the genomic sequence of the virus no later than in november 2019 weeks before chinas official recognition that the virus was circulatingp blockquote p datappblocktypecopy datappid280in other news the authors of the wetmarket orgins preprint that received a lot of a hrefhttpswwwnytimescominteractive20220226sciencecovidviruswuhanoriginshtmlpositive mainstream pressa have a hrefhttpstwittercomjamiemetzlstatus1552076464622911488s20ttnuvwsk493bgzzgsppsdjasubstantially moderated their conclusionsa in the published peerreviewed a hrefhttpswwwscienceorgdoi101126scienceabp8715utm_campaignscimagutm_sourcesocialutm_mediumtwitterarticlea which now only pinpoints the seafood market as an epicenter which everyone already knewp pthe post a relnofollow hrefhttpsmarginalrevolutioncommarginalrevolution202210asafetyemergencyhappenedatthewuhaninstituteofvirologyinnovemberof2019htmla safety emergency happened at the wuhan institute of virology in november of 2019a appeared first on a relnofollow hrefhttpsmarginalrevolutioncommarginal revolutionap

ppropublica vanity fair putting reputation line hrefhttpswwwpropublicaorgarticlesenatereportcovid19originwuhanlabvery damning reporta suggesting covid emerged lab leak wuhan institute virology new information isnt virus political reports indicate kind emergency lab november 2019 emergency xi got involvedp blockquote p datappblocktypecopy datappid260 sent key documents experts ccp communications told wiv dispatches signal institute faced acute safety emergency november 2019 officials highest levels chinese government weighed urgent action taken effort address ongoing safety issues documents clear responsible crisis laboratory affected specifically exact nature biosafety emergency wasp p datappblocktypecopy datappid280[we] separately got experts ccp communications review wiv meeting summary agreed appeared urgent nonroutine related sort biosafety emergency agreed appeared xi issued piship p datappblocktypecopy datappid610a senior intelligence official said pishi [a hrefhttpschinamediaprojectorgthe_ccp_dictionarywrittencommentlinka at] dispatch necessarily smoking gun reads saying issue related lab security doesnt come needed seen xi jinping added signed general secretary xi premier li high priorityp blockquote p datappblocktypecopy datappid610there long found surprisingp blockquote p datappblocktypecopy datappid270the interim report raises questions quickly vaccines developed china teams including led military virologist named zhou yusen report called unusual military covid19 vaccine development teams able reach early milestones faster major drug companies governments operation warp speed programp p datappblocktypecopy datappid280vanity fair propublica spoke experts said timeline zhous vaccine development unrealistic impossible experts said strongly suggested team access genomic sequence virus later november 2019 weeks chinas official recognition virus circulatingp blockquote p datappblocktypecopy datappid280in news authors wetmarket orgins preprint received lot hrefhttpswwwnytimescominteractive20220226sciencecovidviruswuhanoriginshtmlpositive mainstream pressa hrefhttpstwittercomjamiemetzlstatus1552076464622911488s20ttnuvwsk493bgzzgsppsdjasubstantially moderated conclusionsa published peerreviewed hrefhttpswwwscienceorgdoi101126scienceabp8715utm_campaignscimagutm_sourcesocialutm_mediumtwitterarticlea pinpoints seafood market epicenter knewp pthe post relnofollow hrefhttpsmarginalrevolutioncommarginalrevolution202210asafetyemergencyhappenedatthewuhaninstituteofvirologyinnovemberof2019htmla safety emergency happened wuhan institute virology november 2019a appeared relnofollow hrefhttpsmarginalrevolutioncommarginal revolutionap

635d64e022d31a251bbcc00b

The finite pool of worry

pthese rents are more than exhaustedp blockquotepaccording to webers psychological theory of the finite pool of worry people avoid dealing with multiple negative events at the same time consistent with this theory as people worry more about the covid19 pandemic they tend to neglect the problem of climate change here we examine the number and content of climate change discussions on twitter from 2019 through 2021 we show that as covid19 cases and deaths increase climate change tweets have a less negative sentiment there is also less content associated with fear and anger the emotions related to worry and anxiety these results support the finite pool of worry hypothesis and imply that the pandemic redirects public attention from the important problem of climate change mitigationpblockquote phere is a relnoopener hrefhttpswwwpnasorgdoi101073pnas2210988119 target_blankthe full articlea via a relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyroundupspendingpower target_blanktekla  perhaps i could induce you to worry about the finite pool of worryp pthe post a relnofollow hrefhttpsmarginalrevolutioncommarginalrevolution202210thefinitepoolofworryhtmlthe finite pool of worrya appeared first on a relnofollow hrefhttpsmarginalrevolutioncommarginal revolutionap

pthese rents exhaustedp blockquotepaccording webers psychological theory finite pool worry people avoid dealing multiple negative events time consistent theory people worry covid19 pandemic tend neglect problem climate change examine number content climate change discussions twitter 2019 2021 covid19 cases deaths increase climate change tweets negative sentiment content associated fear anger emotions related worry anxiety results support finite pool worry hypothesis imply pandemic redirects public attention important problem climate change mitigationpblockquote phere relnoopener hrefhttpswwwpnasorgdoi101073pnas2210988119 target_blankthe articlea relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyroundupspendingpower target_blanktekla induce worry finite pool worryp pthe post relnofollow hrefhttpsmarginalrevolutioncommarginalrevolution202210thefinitepoolofworryhtmlthe finite pool worrya appeared relnofollow hrefhttpsmarginalrevolutioncommarginal revolutionap

635d665322d31a251bbcc03c

Biden calls Speaker Pelosi to wish Paul Pelosi a speedy recovery

ppresident biden on friday morning called speaker nancy pelosi dcalif following the horrible attack on her husband paul pelosi earlier that morningp pthe president is praying for paul pelosi and for speaker pelosis whole family this morning he called speaker pelosi to express his support after this horrible attack he is also very glad that a full recovery is expected white house press secretary karine jeanpierre said in a statementp pjeanpierre added that the president continues to condemn all violence she said that biden asked for people to respect the pelosi familys desire for privacy at this timep pan assailant broke into the pelosis san francisco residence a hrefhttpsthehillcomhomenewshouse3709050paulpelosiassaultedathomebyassailantearly friday morninga and assaulted paul pelosi who has been taken to the hospital and is expected to make a full recoveryp pthe assailant is in custody the nancy pelosi was in washington dc at the time of the break inp psenate majority leader charles schumer dny also spoke with pelosi on friday to convey his deepest concern and heartfelt wishes to her husband and their family a hrefhttpstwittercomsenschumerstatus1586004880858169348in a statementa he called the attack dastardlyp pother lawmakers are sending well wishes to the pelosi family including sen charles grassley riowa rep jackie speier dcalif and rep diana degette dcolop

ppresident biden friday morning called speaker nancy pelosi dcalif following horrible attack husband paul pelosi earlier morningp pthe president praying paul pelosi speaker pelosis family morning called speaker pelosi express support horrible attack glad recovery expected white house press secretary karine jeanpierre said statementp pjeanpierre added president continues condemn violence said biden asked people respect pelosi familys desire privacy timep pan assailant broke pelosis san francisco residencea hrefhttpsthehillcomhomenewshouse3709050paulpelosiassaultedathomebyassailantearly friday morningaand assaulted paul pelosi taken hospital expected recoveryp pthe assailant custody nancy pelosi washington dc time break inp psenate majority leader charles schumer dny spoke pelosi friday convey deepest concern heartfelt wishes husband familya hrefhttpstwittercomsenschumerstatus1586004880858169348in statementa called attack dastardlyp pother lawmakers sending wishes pelosi family including sen charles grassley riowa rep jackie speier dcalif rep diana degette dcolop

635d66f422d31a251bbcc05a

Biden, Harris to pitch Democrats case at Philadelphia event

ppresident biden and vice president harris in a rare joint campaign appearance as a duo will make the case for democrats in pennsylvania on friday eveningp pthe two are delivering the keynote addresses at the pennsylvania democratic partys annual independence dinner which is expected to raise 1 million for the state party that would be the most amount raised in recent history according to a democratic officialp pbiden and harris will be joined at the event by lieutenant governor john fetterman who holds a narrow lead in most polls over republican mehmet oz in their race for the senate that race is pivotal for democrats looking to keep their control of the senate and biden and harris a relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3705128bidenharristomakerarecampaignappearanceasduotohelpfetterman target_blankjoint appearance in the keystone statea follows a rocky debate performance from fetterman on tuesdayp pbiden is expected to make his closing argument for democrats this cycle which is that the republicans vision for the economy will worsen inflation and undo the good work of democrats so farp pwith less than two weeks to go before election day the president will contrast his vision for continuing to rebuild the economy from the bottom up and the middle out with the republicans mega maga trickle down plan to raise prescription drug costs cut medicare and social security and double down on trumps massive tax cuts for the rich the democratic official saidp pthe president sharpened that message a relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3708512bidensharpenseconomicmessageintriptosyracuse target_blankat an event in syracuse ny on thursdaya where he contrasted his economic record and proposals by republicans who he said appeared to be hoping for a recessionp pbiden and harris will argue that democrats have created 10 million jobs including 700000 manufacturing jobs brought down unemployment and taken action to lower gas prices and costs for american families the official saidp pbiden and harris will also be joined by pennsylvania gov tom wolf d sen bob casey d rep matt cartwright d and democratic national committee chair jaime harrison among othersp

ppresident biden vice president harris rare joint campaign appearance duo case democrats pennsylvania friday eveningp pthe delivering keynote addresses pennsylvania democratic partys annual independence dinner expected raise 1 million state party raised recent history according democratic officialp pbiden harris joined event lieutenant governor john fetterman holds narrow lead polls republican mehmet oz race senate race pivotal democrats looking control senate biden harrisa relnoreferrer noopener hrefhttpsthehillcomhomenewscampaign3705128bidenharristomakerarecampaignappearanceasduotohelpfetterman target_blankjoint appearance keystone stateafollows rocky debate performance fetterman tuesdayp pbiden expected closing argument democrats cycle republicans vision economy worsen inflation undo good work democrats farp pwith weeks election day president contrast vision continuing rebuild economy middle republicans mega maga trickle plan raise prescription drug costs cut medicare social security double trumps massive tax cuts rich democratic official saidp pthe president sharpened messagea relnoreferrer noopener hrefhttpsthehillcomhomenewsadministration3708512bidensharpenseconomicmessageintriptosyracuse target_blankat event syracuse ny thursdaya contrasted economic record proposals republicans said appeared hoping recessionp pbiden harris argue democrats created 10 million jobs including 700000 manufacturing jobs brought unemployment taken action lower gas prices costs american families official saidp pbiden harris joined pennsylvania gov tom wolf d sen bob casey d rep matt cartwright d democratic national committee chair jaime harrison othersp

635d66fb22d31a251bbcc05e

Biden to vote early in Delaware on Saturday

ppresident biden on saturday will cast his vote in the midterm elections in wilmington del the white house announced on fridayp phe will be early voting in his hometown with his granddaughter natalie who is a firsttime voter  natalie 18 is the daughter of bidens late son beau bidenp pbiden will cast his ballot on saturday following a trip to philadelphia for a campaign rally on friday the president and vice president harris are delivering the keynote addresses at the pennsylvania democratic partys annual independence dinner on friday evening where they are expected to give closing messages in support of democrats this cycle as they look to hold onto their control of congressp pwhile delaware is a typically safe state for democrats including this cycle the senate race in pennsylvania is a top race to watch for the control of the upper chamber democrat john fetterman had a rocky performance against republican mehmet oz at their debate on tuesday and while fetterman is holding onto a narrow lead in most polling against oz the race is rated as a toss up by the nonpartisan cook political reportp pbiden in september took an unexpected trip to delaware to cast his ballot in the primary election he flew to wilmington in the evening and was back at the white house within four hours at the timep

ppresident biden saturday cast vote midterm elections wilmington del white house announced fridayp phe early voting hometown granddaughter natalie firsttime voter natalie 18 daughter bidens late son beau bidenp pbiden cast ballot saturday following trip philadelphia campaign rally friday president vice president harris delivering keynote addresses pennsylvania democratic partys annual independence dinner friday evening expected closing messages support democrats cycle look hold control congressp pwhile delaware typically safe state democrats including cycle senate race pennsylvania race watch control upper chamber democrat john fetterman rocky performance republican mehmet oz debate tuesday fetterman holding narrow lead polling oz race rated toss nonpartisan cook political reportp pbiden september took unexpected trip delaware cast ballot primary election flew wilmington evening white house hours timep

635d682222d31a251bbcc089

A global beacon on climate change

pjean salata is a climate optimist enough to often elicit a gentle eyeroll from his wife melaniep pi am very optimistic and as i was joking last night my wife would say that im delusional salata said wednesdayp pdespite that optimism salata ceo of one of asias largest private equity firms baring private equity asia isnt kidding himself about the complexities of the climate crisis he knows it is a multifaceted global issue that will affect the world his children and grandchildren inherit but he decided that his best shot for making a real difference was to find a place with robust resources deep talent and the right leaders and then just step back and he said that is what he didp pim optimistic that we can make a difference salata said at the kickoff event of the new institute that bears his and melanies name its not going to be easy were not going to do it alone we can galvanize all the resources that the university has to be a beacon to the rest of the world almost like a call to action of why this is important and how we together are going to solve this problemp pseveral speakers at wednesdays event the future is now harvard takes on the climate challenge cited harvards broad interdisciplinary breadth and leadership in higher education as reasons why it is imperative the university engage fully on the problem they said the new salata institute for climate and sustainability will fill an important role in the array of research teaching and other activities related to climate change taking place on harvards campuses indeed a recent report commissioned by james stock vice provost for climate and sustainability concluded that despite the abundance of climate changerelated courses events research opportunities internships and other types of engagement already offered at the university there remains a huge desire for morep pthe salata institute which stock will head seeks to play a unifying catalyzing role that ultimately brings a universitywide focus to a massive complex and existential dilemma that has at times driven researchers scholars and students nearly to the point of throwing up their hands in resignationp div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202210102622_salata_9271350x900jpg width1350 altjean salata srcsethttpsnewsharvardeduwpcontentuploads202210102622_salata_9271350x900jpg 1350w httpsnewsharvardeduwpcontentuploads202210102622_salata_927300x200jpg 300w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271024x683jpg 1024w httpsnewsharvardeduwpcontentuploads202210102622_salata_927768x512jpg 768w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271536x1024jpg 1536w httpsnewsharvardeduwpcontentuploads202210102622_salata_9272048x1366jpg 2048w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271200x800jpg 1200w httpsnewsharvardeduwpcontentuploads202210102622_salata_927900x600jpg 900w httpsnewsharvardeduwpcontentuploads202210102622_salata_927400x267jpg 400w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271500x1000jpg 1500w height900 div figcaption pim optimistic that we can make a difference its not going to be easy were not going to do it alone said jean salata at the kickoff event of the new salata institutep figcaption figure div div div div peven that distress however points to the importance of an allencompassing approach according to daniel schrag the sturgis hooper professor of geology and director of the harvard university center for the environment during a panel discussion on wednesday afternoon at radcliffes knafel center schrag recounted a discussion with matthew potts plummer professor of christian morals about his freshman seminar apocalyptic grief love loss and the end of the world and the importance of dealing not just with facts and policy but also with hope despair and other emotions in the face of war pandemic the climate crisis and problems that at times seem ready to overwhelm usp pschrag said that often during discussions of the geologic timescale of the changes we are making it can take 100000 years for carbon were putting in the atmosphere to be removed by natural processes students nearly despair over the possibility of finding a solution and though every day we delay makes the problem worse it is also true he said that its never going to be too latep pits never too late for us to act on climate system theres no threshold beyond which we shouldnt act we have an obligation to keep working to solve this problem whatever the impacts are schrag said we have an obligation to continue to work on the social justice issues associated with this problem whatever impacts happenp pthe panel moderated by jody freeman archibald cox professor of law and director of the energy and environmental law program also included caroline buckee professor of epidemiology bridget long dean of the graduate school of education naomi oreskes henry charles lea professor of the history of science robert stavins aj meyer professor of energy amp economic development and director of the harvard project on climate agreements and michael toffel the senator john heinz professor of environmental management at harvard business schoolp ppanelists described a range of different impacts in their disciplines as well as activity going on at harvard in those areas long said climate change is an important issue in americas schools both as a subject for instruction and a factor affecting learning a 100degree heat wave last spring struck while schools including many without air conditioning were in session in addition she said schools are an important institution because while decentralized they stretch across america penetrating every community they are enormous consumers of electricity cover some 2 million acres of land and operate approximately 7 million buses making the choices of education leaders important in enacting solutionsp pwhile interdisciplinarity is important the event also offered a snapshot of climate science and policy the good news stavins said is that governments around the world have committed to address the problem with those representing 97 percent of global admissions signed onto the paris accord the bad news is that their commitments to reduce emissions are nowhere close to what will be needed to keep warming to 15 degrees celsius over preindustrial levels a threshold below which experts believe the worst effects of climate change can be averted efforts he said are turning to how to raise those levels of commitmentp pschrag and oreskes said that the science has moved past the nowsettled debate over the problems roots in fossilfuel burning to advances in attribution science which determine how much climate change influences weather events and in forecasting what shifts to expectp pthough the scientific debate over climate change has been settled for some time oreskes said it isnt over in many parts of the country misinformation and disinformation are still a problem and another significant hurdle is the fact that fossil fuel extraction provides lots of jobs and though there are promises of retraining people holding those jobs only have to look to americas rust belt to see how well they were kept in the pastp pwe can have the best science in the world but if people dont accept it and act on it it doesnt matter oreskes saidp pstock who offered closing remarks said the new institute will be operating at a time of transformational change both in the climate and in society as energysource transitions and other climaterelated changes accelerate the transition should be approached he said with an eye not just to problems but also to the opportunities to address inequities in societyp pits hard to imagine how vast and consequential the next 30 years will be stock saidpdivdivdiv

pjean salata climate optimist elicit gentle eyeroll wife melaniep pi optimistic joking night wife im delusional salata said wednesdayp pdespite optimism salata ceo asias largest private equity firms baring private equity asia isnt kidding complexities climate crisis knows multifaceted global issue affect world children grandchildren inherit decided best shot making real difference find place robust resources deep talent right leaders step said didp pim optimistic difference salata said kickoff event new institute bears melanies going easy going galvanize resources university beacon rest world like action important going solve problemp pseveral speakers wednesdays event future harvard takes climate challenge cited harvards broad interdisciplinary breadth leadership higher education reasons imperative university engage fully problem said new salata institute climate sustainability fill important role array research teaching activities related climate change taking place harvards campuses recent report commissioned james stock vice provost climate sustainability concluded despite abundance climate changerelated courses events research opportunities internships types engagement offered university remains huge desire morep pthe salata institute stock head seeks play unifying catalyzing role ultimately brings universitywide focus massive complex existential dilemma times driven researchers scholars students nearly point throwing hands resignationp div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202210102622_salata_9271350x900jpg width1350 altjean salata srcsethttpsnewsharvardeduwpcontentuploads202210102622_salata_9271350x900jpg 1350w httpsnewsharvardeduwpcontentuploads202210102622_salata_927300x200jpg 300w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271024x683jpg 1024w httpsnewsharvardeduwpcontentuploads202210102622_salata_927768x512jpg 768w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271536x1024jpg 1536w httpsnewsharvardeduwpcontentuploads202210102622_salata_9272048x1366jpg 2048w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271200x800jpg 1200w httpsnewsharvardeduwpcontentuploads202210102622_salata_927900x600jpg 900w httpsnewsharvardeduwpcontentuploads202210102622_salata_927400x267jpg 400w httpsnewsharvardeduwpcontentuploads202210102622_salata_9271500x1000jpg 1500w height900 div figcaption pim optimistic difference going easy going said jean salata kickoff event new salata institutep figcaption figure div div div div peven distress points importance allencompassing approach according daniel schrag sturgis hooper professor geology director harvard university center environment panel discussion wednesday afternoon radcliffes knafel center schrag recounted discussion matthew potts plummer professor christian morals freshman seminar apocalyptic grief love loss end world importance dealing facts policy hope despair emotions face war pandemic climate crisis problems times ready overwhelm usp pschrag said discussions geologic timescale changes making 100000 years carbon putting atmosphere removed natural processes students nearly despair possibility finding solution day delay makes problem worse true said going latep pits late act climate system theres threshold shouldnt act obligation working solve problem impacts schrag said obligation continue work social justice issues associated problem impacts happenp pthe panel moderated jody freeman archibald cox professor law director energy environmental law program included caroline buckee professor epidemiology bridget long dean graduate school education naomi oreskes henry charles lea professor history science robert stavins aj meyer professor energy amp economic development director harvard project climate agreements michael toffel senator john heinz professor environmental management harvard business schoolp ppanelists described range different impacts disciplines activity going harvard areas long said climate change important issue americas schools subject instruction factor affecting learning 100degree heat wave spring struck schools including air conditioning session addition said schools important institution decentralized stretch america penetrating community enormous consumers electricity cover 2 million acres land operate approximately 7 million buses making choices education leaders important enacting solutionsp pwhile interdisciplinarity important event offered snapshot climate science policy good news stavins said governments world committed address problem representing 97 percent global admissions signed paris accord bad news commitments reduce emissions close needed warming 15 degrees celsius preindustrial levels threshold experts believe worst effects climate change averted efforts said turning raise levels commitmentp pschrag oreskes said science moved past nowsettled debate problems roots fossilfuel burning advances attribution science determine climate change influences weather events forecasting shifts expectp pthough scientific debate climate change settled time oreskes said isnt parts country misinformation disinformation problem significant hurdle fact fossil fuel extraction provides lots jobs promises retraining people holding jobs look americas rust belt kept pastp pwe best science world people dont accept act doesnt matter oreskes saidp pstock offered closing remarks said new institute operating time transformational change climate society energysource transitions climaterelated changes accelerate transition approached said eye problems opportunities address inequities societyp pits hard imagine vast consequential 30 years stock saidpdivdivdiv